BLASTX nr result
ID: Zingiber23_contig00053399
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00053399 (302 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004506472.1| PREDICTED: uncharacterized aarF domain-conta... 57 3e-06 >ref|XP_004506472.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic-like isoform X1 [Cicer arietinum] gi|502146484|ref|XP_004506473.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic-like isoform X2 [Cicer arietinum] Length = 717 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/52 (50%), Positives = 35/52 (67%) Frame = -3 Query: 300 DSFDPSLLQPLIQVLEEPEARKLGGRLFGGVXXXXXXXXXXXXXRSPITAST 145 + FDPSLLQP++QVL++PEAR+LGGR+ GG+ +P TAST Sbjct: 666 NDFDPSLLQPILQVLQQPEARRLGGRVVGGITQRLAARFLLQLLGAPTTAST 717