BLASTX nr result
ID: Zingiber23_contig00053074
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00053074 (298 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001686788.1| putative coat protein [Rose cryptic virus 1]... 51 1e-06 >ref|YP_001686788.1| putative coat protein [Rose cryptic virus 1] gi|157849944|gb|ABV89763.1| unknown [Rosa multiflora cryptic virus] gi|167077477|gb|ABZ10947.1| putative coat protein [Rose cryptic virus 1] Length = 346 Score = 51.2 bits (121), Expect(2) = 1e-06 Identities = 23/55 (41%), Positives = 31/55 (56%) Frame = +1 Query: 1 LKTGSPWWTYNYQLYHDHYDLRCIFPPSNYSDHTCILASMFLGTIGNPPSPTQIM 165 +K+GS WWTY H DL C PP+NYSD L S+FL T + ++I+ Sbjct: 251 IKSGSAWWTYKLNNAHGTTDLVCTIPPTNYSDLGVALRSLFLATAADSDECSEII 305 Score = 26.9 bits (58), Expect(2) = 1e-06 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 194 PDGYQFRAFAALCHAPREE 250 P RAF ALCH P EE Sbjct: 322 PPNSNIRAFLALCHGPLEE 340