BLASTX nr result
ID: Zingiber23_contig00052421
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00052421 (273 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY22664.1| Tetratricopeptide repeat (TPR)-like superfamily p... 55 1e-05 gb|EOY22663.1| Tetratricopeptide repeat-like superfamily protein... 55 1e-05 >gb|EOY22664.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 2 [Theobroma cacao] Length = 542 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/38 (57%), Positives = 31/38 (81%) Frame = -3 Query: 271 YVLLSNIYADARSWDTAERIRELMEKREVRKMLGSSWI 158 YVLLSNIY + W++AER+RE+M+K+ +RK+ G SWI Sbjct: 376 YVLLSNIYCSVKKWESAERLREMMKKKGIRKIRGRSWI 413 >gb|EOY22663.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] Length = 568 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/38 (57%), Positives = 31/38 (81%) Frame = -3 Query: 271 YVLLSNIYADARSWDTAERIRELMEKREVRKMLGSSWI 158 YVLLSNIY + W++AER+RE+M+K+ +RK+ G SWI Sbjct: 376 YVLLSNIYCSVKKWESAERLREMMKKKGIRKIRGRSWI 413