BLASTX nr result
ID: Zingiber23_contig00052399
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00052399 (293 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002453091.1| hypothetical protein SORBIDRAFT_04g038305 [S... 75 7e-12 gb|AFW74147.1| hypothetical protein ZEAMMB73_269656 [Zea mays] 67 2e-09 ref|XP_002265420.1| PREDICTED: pentatricopeptide repeat-containi... 65 7e-09 emb|CBI31119.3| unnamed protein product [Vitis vinifera] 65 7e-09 ref|XP_004954507.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 gb|EMJ22674.1| hypothetical protein PRUPE_ppa004164mg [Prunus pe... 62 6e-08 ref|XP_006481967.1| PREDICTED: pentatricopeptide repeat-containi... 62 8e-08 ref|XP_006649201.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_006430418.1| hypothetical protein CICLE_v10011492mg [Citr... 62 1e-07 ref|NP_001048611.1| Os02g0830000 [Oryza sativa Japonica Group] g... 60 2e-07 gb|EAY88112.1| hypothetical protein OsI_09550 [Oryza sativa Indi... 60 2e-07 gb|EMT03787.1| hypothetical protein F775_12207 [Aegilops tauschii] 60 3e-07 ref|XP_004981246.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 gb|EMT32214.1| hypothetical protein F775_11465 [Aegilops tauschii] 60 4e-07 ref|XP_003559233.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 gb|EXB87349.1| Serine/threonine-protein phosphatase PP2A-4 catal... 59 5e-07 ref|XP_004138859.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 gb|AFW67143.1| hypothetical protein ZEAMMB73_912965 [Zea mays] 58 1e-06 ref|NP_001145890.1| uncharacterized protein LOC100279406 [Zea ma... 58 1e-06 ref|XP_003604365.1| Pentatricopeptide repeat-containing protein ... 58 2e-06 >ref|XP_002453091.1| hypothetical protein SORBIDRAFT_04g038305 [Sorghum bicolor] gi|241932922|gb|EES06067.1| hypothetical protein SORBIDRAFT_04g038305 [Sorghum bicolor] Length = 514 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/57 (63%), Positives = 45/57 (78%) Frame = -2 Query: 289 RRAMEVRQAMKVPGCSMVEVDGVAYEFVAGDRSHKQIKEIISAIRGIDKQLRSFSND 119 RR M+ R+ KVPGCSM+EVDGVA EFVAGDRSH +++EI+SAIR + QLR +D Sbjct: 457 RRTMDQRKVAKVPGCSMLEVDGVASEFVAGDRSHPRMQEIMSAIRDLHGQLRQLDHD 513 >gb|AFW74147.1| hypothetical protein ZEAMMB73_269656 [Zea mays] Length = 524 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/57 (59%), Positives = 40/57 (70%) Frame = -2 Query: 289 RRAMEVRQAMKVPGCSMVEVDGVAYEFVAGDRSHKQIKEIISAIRGIDKQLRSFSND 119 RR ME R+ KVPGCSM+EV GV EFVAGDRSH + EI+SA R + QLR +D Sbjct: 455 RRDMEERRVAKVPGCSMLEVGGVVCEFVAGDRSHPLMPEIMSASRDLHGQLRQLDHD 511 >ref|XP_002265420.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 537 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/53 (54%), Positives = 39/53 (73%) Frame = -2 Query: 289 RRAMEVRQAMKVPGCSMVEVDGVAYEFVAGDRSHKQIKEIISAIRGIDKQLRS 131 R+ ME ++ KVPGCS++EVDG +EFVAGD SH + EI+ + GIDK L+S Sbjct: 471 RKGMEEKKVKKVPGCSLIEVDGAVFEFVAGDMSHVFMDEIVLLLLGIDKHLKS 523 >emb|CBI31119.3| unnamed protein product [Vitis vinifera] Length = 512 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/53 (54%), Positives = 39/53 (73%) Frame = -2 Query: 289 RRAMEVRQAMKVPGCSMVEVDGVAYEFVAGDRSHKQIKEIISAIRGIDKQLRS 131 R+ ME ++ KVPGCS++EVDG +EFVAGD SH + EI+ + GIDK L+S Sbjct: 446 RKGMEEKKVKKVPGCSLIEVDGAVFEFVAGDMSHVFMDEIVLLLLGIDKHLKS 498 >ref|XP_004954507.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Setaria italica] Length = 499 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/47 (63%), Positives = 38/47 (80%) Frame = -2 Query: 259 KVPGCSMVEVDGVAYEFVAGDRSHKQIKEIISAIRGIDKQLRSFSND 119 KVPGCSMVEVDGVA EFVAGDRSH+++ +I+SA+R + LR +D Sbjct: 449 KVPGCSMVEVDGVACEFVAGDRSHRRMPDIMSAVRDLHAHLRHRFDD 495 >gb|EMJ22674.1| hypothetical protein PRUPE_ppa004164mg [Prunus persica] Length = 526 Score = 62.4 bits (150), Expect = 6e-08 Identities = 33/63 (52%), Positives = 42/63 (66%), Gaps = 2/63 (3%) Frame = -2 Query: 289 RRAMEVRQAMKVPGCSMVEVDGVAYEFVAGDRSHKQIKEIISAIRGIDKQLRS--FSNDP 116 R+ ME ++ KVPGCS+VEV+G +EFVAGDRSH + EI+ A IDK L+S F D Sbjct: 462 RKGMEEKKVRKVPGCSLVEVNGEVFEFVAGDRSHVLMDEIMLASLVIDKHLKSRCFDRDD 521 Query: 115 SAI 107 I Sbjct: 522 DKI 524 >ref|XP_006481967.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Citrus sinensis] Length = 546 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/53 (52%), Positives = 40/53 (75%) Frame = -2 Query: 289 RRAMEVRQAMKVPGCSMVEVDGVAYEFVAGDRSHKQIKEIISAIRGIDKQLRS 131 RR ME + KVPGCS++EVDGV EFV+G+R++ ++EI+ + GIDK L+S Sbjct: 470 RRGMEDNEVRKVPGCSLIEVDGVVCEFVSGERTNVLMEEIVLLLFGIDKHLKS 522 >ref|XP_006649201.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Oryza brachyantha] Length = 504 Score = 61.6 bits (148), Expect = 1e-07 Identities = 34/52 (65%), Positives = 37/52 (71%) Frame = -2 Query: 289 RRAMEVRQAMKVPGCSMVEVDGVAYEFVAGDRSHKQIKEIISAIRGIDKQLR 134 RR ME R+ +KVPGCSMVEVDGVA EFVAGDRS Q II +D QLR Sbjct: 448 RRGMEERRVLKVPGCSMVEVDGVAREFVAGDRS--QEAWIIDVAEQLDAQLR 497 >ref|XP_006430418.1| hypothetical protein CICLE_v10011492mg [Citrus clementina] gi|557532475|gb|ESR43658.1| hypothetical protein CICLE_v10011492mg [Citrus clementina] Length = 519 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/53 (52%), Positives = 40/53 (75%) Frame = -2 Query: 289 RRAMEVRQAMKVPGCSMVEVDGVAYEFVAGDRSHKQIKEIISAIRGIDKQLRS 131 RR ME + KVPGCS++EVDGV EFV+G+R++ ++EI+ + GIDK L+S Sbjct: 446 RRGMEDNEVRKVPGCSLIEVDGVICEFVSGERTNVLMEEIVLLLFGIDKHLKS 498 >ref|NP_001048611.1| Os02g0830000 [Oryza sativa Japonica Group] gi|48716334|dbj|BAD22946.1| pentatricopeptide repeat-containing protein-like [Oryza sativa Japonica Group] gi|113538142|dbj|BAF10525.1| Os02g0830000 [Oryza sativa Japonica Group] gi|125584254|gb|EAZ25185.1| hypothetical protein OsJ_08985 [Oryza sativa Japonica Group] Length = 500 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -2 Query: 289 RRAMEVRQAMKVPGCSMVEVDGVAYEFVAGDRSHK 185 RR ME R+ +KVPGCSMVEVDGVA EFVAGDRSH+ Sbjct: 449 RRGMEERKVVKVPGCSMVEVDGVAREFVAGDRSHE 483 >gb|EAY88112.1| hypothetical protein OsI_09550 [Oryza sativa Indica Group] Length = 500 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -2 Query: 289 RRAMEVRQAMKVPGCSMVEVDGVAYEFVAGDRSHK 185 RR ME R+ +KVPGCSMVEVDGVA EFVAGDRSH+ Sbjct: 449 RRGMEERKVVKVPGCSMVEVDGVAREFVAGDRSHE 483 >gb|EMT03787.1| hypothetical protein F775_12207 [Aegilops tauschii] Length = 588 Score = 60.1 bits (144), Expect = 3e-07 Identities = 32/57 (56%), Positives = 39/57 (68%) Frame = -2 Query: 289 RRAMEVRQAMKVPGCSMVEVDGVAYEFVAGDRSHKQIKEIISAIRGIDKQLRSFSND 119 R ME ++ KVPGCSMVEVDGVA EFVAGDR I + +RG+D+QLR +D Sbjct: 447 RSVMEEKKVAKVPGCSMVEVDGVACEFVAGDRFLDPC--INTVVRGLDQQLRLLGHD 501 >ref|XP_004981246.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X1 [Setaria italica] gi|514812916|ref|XP_004981247.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X2 [Setaria italica] Length = 615 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/65 (43%), Positives = 41/65 (63%) Frame = -2 Query: 289 RRAMEVRQAMKVPGCSMVEVDGVAYEFVAGDRSHKQIKEIISAIRGIDKQLRSFSNDPSA 110 RR M R KVPGCS+VE+DG +EF+AGD SH Q KEI + + ++LR + P+ Sbjct: 469 RREMSKRGFKKVPGCSVVELDGEVHEFIAGDESHPQWKEIYRMVEEMARELRRIGHIPAT 528 Query: 109 I*IIM 95 +++ Sbjct: 529 SEVLL 533 >gb|EMT32214.1| hypothetical protein F775_11465 [Aegilops tauschii] Length = 452 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/52 (51%), Positives = 35/52 (67%) Frame = -2 Query: 289 RRAMEVRQAMKVPGCSMVEVDGVAYEFVAGDRSHKQIKEIISAIRGIDKQLR 134 RR M R KVPGCS+VE+DG +EF+AGD SH Q KEI + + ++LR Sbjct: 318 RREMSKRGITKVPGCSLVELDGEVHEFIAGDESHPQYKEIYRMVEEMSRELR 369 >ref|XP_003559233.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Brachypodium distachyon] Length = 611 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/52 (51%), Positives = 35/52 (67%) Frame = -2 Query: 289 RRAMEVRQAMKVPGCSMVEVDGVAYEFVAGDRSHKQIKEIISAIRGIDKQLR 134 RR M R KVPGCS+VE+DG +EF+AGD SH Q KEI + + ++LR Sbjct: 465 RREMSKRGIKKVPGCSLVELDGEVHEFIAGDESHPQYKEIYRMVEEMSRELR 516 >gb|EXB87349.1| Serine/threonine-protein phosphatase PP2A-4 catalytic subunit [Morus notabilis] Length = 783 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/44 (56%), Positives = 34/44 (77%) Frame = -2 Query: 289 RRAMEVRQAMKVPGCSMVEVDGVAYEFVAGDRSHKQIKEIISAI 158 R+ ME+++ KVPGCS +EVDG+ YEFVAGDRSH + EI+ + Sbjct: 462 RKKMEMKKVAKVPGCSSIEVDGLVYEFVAGDRSHVLMDEIVRTL 505 >ref|XP_004138859.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cucumis sativus] gi|449529652|ref|XP_004171812.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cucumis sativus] Length = 606 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/65 (41%), Positives = 41/65 (63%) Frame = -2 Query: 289 RRAMEVRQAMKVPGCSMVEVDGVAYEFVAGDRSHKQIKEIISAIRGIDKQLRSFSNDPSA 110 R MEV+ KVPG +M+E+D YEFVAGD+SHKQ KEI + + ++++ PS Sbjct: 460 REVMEVKGMKKVPGSTMIEIDNEIYEFVAGDKSHKQHKEIYEMVDEMGREMKKSGYRPST 519 Query: 109 I*IIM 95 +++ Sbjct: 520 SEVLL 524 >gb|AFW67143.1| hypothetical protein ZEAMMB73_912965 [Zea mays] Length = 619 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/52 (51%), Positives = 35/52 (67%) Frame = -2 Query: 289 RRAMEVRQAMKVPGCSMVEVDGVAYEFVAGDRSHKQIKEIISAIRGIDKQLR 134 RR M R KVPGCS+VE+DG +EF+AGD SH Q KEI + + ++LR Sbjct: 473 RREMSKRGIKKVPGCSLVELDGEVHEFIAGDESHPQWKEIYMMVEEMARELR 524 >ref|NP_001145890.1| uncharacterized protein LOC100279406 [Zea mays] gi|219884839|gb|ACL52794.1| unknown [Zea mays] Length = 318 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/52 (51%), Positives = 35/52 (67%) Frame = -2 Query: 289 RRAMEVRQAMKVPGCSMVEVDGVAYEFVAGDRSHKQIKEIISAIRGIDKQLR 134 RR M R KVPGCS+VE+DG +EF+AGD SH Q KEI + + ++LR Sbjct: 172 RREMSKRGIKKVPGCSLVELDGEVHEFIAGDESHPQWKEIYMMVEEMARELR 223 >ref|XP_003604365.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355505420|gb|AES86562.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 874 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/58 (43%), Positives = 38/58 (65%) Frame = -2 Query: 289 RRAMEVRQAMKVPGCSMVEVDGVAYEFVAGDRSHKQIKEIISAIRGIDKQLRSFSNDP 116 R+ M R K+PGCS++E++G+ YEFVAGD+SH Q KEI + + + + L + P Sbjct: 598 RKMMMERGIKKIPGCSLMEMNGIVYEFVAGDKSHPQSKEIYAKLENMKQDLSNAGYSP 655