BLASTX nr result
ID: Zingiber23_contig00052218
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00052218 (296 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004956972.1| PREDICTED: putative clathrin assembly protei... 49 3e-06 >ref|XP_004956972.1| PREDICTED: putative clathrin assembly protein At1g25240-like [Setaria italica] Length = 390 Score = 48.5 bits (114), Expect(2) = 3e-06 Identities = 20/39 (51%), Positives = 28/39 (71%) Frame = -2 Query: 253 HHLRRRPEAVRATSHDEVSVDYKNAGRVFAWARAAPSTL 137 HH +RATSH++ +DY++A RVFAWAR +PS+L Sbjct: 39 HHRELEAAVIRATSHEDRWMDYRSAARVFAWARTSPSSL 77 Score = 28.1 bits (61), Expect(2) = 3e-06 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -1 Query: 128 PDVWTAARRVSRTCSWSVA-XXXXXXXXXXLCYDDVPPSARVG 3 P +W ARR RT W VA LC PP+AR G Sbjct: 79 PAMWALARRARRTRCWVVALKALMVAHGLLLCSGLAPPAARAG 121