BLASTX nr result
ID: Zingiber23_contig00052194
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00052194 (290 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526679.1| DNA-damage-inducible protein f, putative [Ri... 55 9e-06 >ref|XP_002526679.1| DNA-damage-inducible protein f, putative [Ricinus communis] gi|223533979|gb|EEF35701.1| DNA-damage-inducible protein f, putative [Ricinus communis] Length = 560 Score = 55.1 bits (131), Expect = 9e-06 Identities = 36/82 (43%), Positives = 47/82 (57%), Gaps = 4/82 (4%) Frame = -1 Query: 242 PNTEHLLFRRTTHLRTQNRRSPRQKAKHRPSDTFQPLLSS----VSRLLDRIRGDDINLE 75 P + H +T L T+ + P + P+ + LL S VSRL D R D+I +E Sbjct: 44 PKSSHKKTTTSTSLETELK--PSVSREQEPTPSTSSLLHSFSRFVSRLRDGFRVDEIGIE 101 Query: 74 ILGIAVPAMLALAADPIALLVE 9 IL IA+PA LALAADPIA LV+ Sbjct: 102 ILSIALPAALALAADPIASLVD 123