BLASTX nr result
ID: Zingiber23_contig00052179
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00052179 (243 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_005090378.1| ATP synthase F0 subunit 1 (mitochondrion) [P... 65 1e-08 ref|YP_006280950.1| ATPase subunit 1 (mitochondrion) [Spirodela ... 64 2e-08 ref|YP_003587244.1| ATPase subunit 1 [Citrullus lanatus] gi|2591... 64 2e-08 ref|YP_008999606.1| ATPase subunit 1 (mitochondrion) [Vaccinium ... 62 1e-07 ref|XP_004987299.1| PREDICTED: ATP synthase subunit alpha, mitoc... 62 1e-07 dbj|BAE32582.1| unnamed protein product [Mus musculus] 61 1e-07 ref|YP_002608189.1| ATP synthase F1 subunit 1 [Carica papaya] gi... 61 1e-07 gb|AHA47112.1| ATP synthase F1 subunit 1 (mitochondrion) [Ambore... 61 2e-07 gb|AGI48792.1| ATP synthase subunits 1 (mitochondrion) [Lolium p... 60 2e-07 dbj|BAO50884.1| ATP synthase F1 subunit 1 (mitochondrion) [Hevea... 60 4e-07 emb|CBI38498.3| unnamed protein product [Vitis vinifera] 60 4e-07 ref|YP_002608395.1| ATPase subunit 1 [Vitis vinifera] gi|2099541... 60 4e-07 ref|YP_006666125.1| ATP1 (mitochondrion) [Malus domestica] gi|40... 59 5e-07 gb|ABY55213.1| Atp1 [Bambusa oldhamii] 59 5e-07 ref|YP_398393.1| atp1 [Triticum aestivum] gi|556927028|ref|YP_00... 59 7e-07 sp|P12862.1|ATPAM_WHEAT RecName: Full=ATP synthase subunit alpha... 59 7e-07 gb|EMT32681.1| ATP synthase subunit alpha, mitochondrial [Aegilo... 59 7e-07 gb|EMT32679.1| ATP synthase subunit alpha, mitochondrial [Aegilo... 59 7e-07 gb|EMS53051.1| ATP synthase subunit alpha, mitochondrial [Tritic... 59 7e-07 gb|EMS52683.1| ATP synthase subunit alpha, mitochondrial [Tritic... 59 7e-07 >ref|YP_005090378.1| ATP synthase F0 subunit 1 (mitochondrion) [Phoenix dactylifera] gi|343478430|gb|AEM43918.1| ATP synthase F0 subunit 1 (mitochondrion) [Phoenix dactylifera] Length = 509 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 241 IDPELLKSFLEKGGLTNERKIELDAFLKESALPYL 137 IDPELLKSFLEKGGLTNERK+E DA LKESALPYL Sbjct: 475 IDPELLKSFLEKGGLTNERKMEPDASLKESALPYL 509 >ref|YP_006280950.1| ATPase subunit 1 (mitochondrion) [Spirodela polyrhiza] gi|385252652|gb|AFI54960.1| ATPase subunit 1 (mitochondrion) [Spirodela polyrhiza] Length = 507 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 241 IDPELLKSFLEKGGLTNERKIELDAFLKESALPYL 137 +DPELLKSFLEKGGLTNERK+E DA LKESALPYL Sbjct: 473 VDPELLKSFLEKGGLTNERKMEPDASLKESALPYL 507 >ref|YP_003587244.1| ATPase subunit 1 [Citrullus lanatus] gi|259156761|gb|ACV96623.1| ATPase subunit 1 [Citrullus lanatus] Length = 509 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 241 IDPELLKSFLEKGGLTNERKIELDAFLKESALPYL 137 I PELL+S LEKGGLTNERK+ELDAFLKESALPYL Sbjct: 475 IKPELLQSLLEKGGLTNERKMELDAFLKESALPYL 509 >ref|YP_008999606.1| ATPase subunit 1 (mitochondrion) [Vaccinium macrocarpon] gi|549531680|gb|AGX28819.1| ATPase subunit 1 (mitochondrion) [Vaccinium macrocarpon] Length = 510 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -3 Query: 241 IDPELLKSFLEKGGLTNERKIELDAFLKESALPYL 137 + PELLKS LEKGGLTNE+++ELDAFL+ESALPYL Sbjct: 475 VKPELLKSLLEKGGLTNEKRMELDAFLRESALPYL 509 >ref|XP_004987299.1| PREDICTED: ATP synthase subunit alpha, mitochondrial-like [Setaria italica] Length = 509 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 241 IDPELLKSFLEKGGLTNERKIELDAFLKESALPYL 137 I+PELLKSFLEKGGLTNERK+E DA LKE+ALPYL Sbjct: 475 INPELLKSFLEKGGLTNERKMEPDASLKENALPYL 509 >dbj|BAE32582.1| unnamed protein product [Mus musculus] Length = 509 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 241 IDPELLKSFLEKGGLTNERKIELDAFLKESALPYL 137 I PELL+S LEKGGLTNERK+E DAFLKESALPYL Sbjct: 475 IKPELLQSLLEKGGLTNERKMEPDAFLKESALPYL 509 >ref|YP_002608189.1| ATP synthase F1 subunit 1 [Carica papaya] gi|170522368|gb|ACB20478.1| ATP synthase F1 subunit 1 (mitochondrion) [Carica papaya] Length = 509 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 241 IDPELLKSFLEKGGLTNERKIELDAFLKESALPYL 137 I PELL+S LEKGGLTNERK+E DAFLKESALPYL Sbjct: 475 IKPELLQSLLEKGGLTNERKMEPDAFLKESALPYL 509 >gb|AHA47112.1| ATP synthase F1 subunit 1 (mitochondrion) [Amborella trichopoda] Length = 506 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 241 IDPELLKSFLEKGGLTNERKIELDAFLKESALPYL 137 IDPELL+S LEKGGLTNERK+E DA LKESALPYL Sbjct: 472 IDPELLQSLLEKGGLTNERKMEPDASLKESALPYL 506 >gb|AGI48792.1| ATP synthase subunits 1 (mitochondrion) [Lolium perenne] Length = 509 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 241 IDPELLKSFLEKGGLTNERKIELDAFLKESALPYL 137 I+PEL KSFLEKGGLTNERK+E DA LKESALPYL Sbjct: 475 INPELQKSFLEKGGLTNERKMEPDASLKESALPYL 509 >dbj|BAO50884.1| ATP synthase F1 subunit 1 (mitochondrion) [Hevea brasiliensis] gi|584592174|dbj|BAO50925.1| ATP synthase F1 subunit 1 (mitochondrion) [Hevea brasiliensis] Length = 509 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 241 IDPELLKSFLEKGGLTNERKIELDAFLKESALPYL 137 I PELL+S LEKGGLTNERK+E DAFLKESALP+L Sbjct: 475 IKPELLQSLLEKGGLTNERKMEPDAFLKESALPFL 509 >emb|CBI38498.3| unnamed protein product [Vitis vinifera] Length = 294 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -3 Query: 241 IDPELLKSFLEKGGLTNERKIELDAFLKESALPYL 137 I PE L+S LEKGGLTNERK+E DAFLKESALPYL Sbjct: 260 IKPEFLQSLLEKGGLTNERKMEPDAFLKESALPYL 294 >ref|YP_002608395.1| ATPase subunit 1 [Vitis vinifera] gi|209954192|emb|CAQ77653.1| ATPase subunit 1 [Vitis vinifera] gi|239764719|gb|ACS15190.1| ATPase subunit 1 [Vitis vinifera] Length = 509 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -3 Query: 241 IDPELLKSFLEKGGLTNERKIELDAFLKESALPYL 137 I PE L+S LEKGGLTNERK+E DAFLKESALPYL Sbjct: 475 IKPEFLQSLLEKGGLTNERKMEPDAFLKESALPYL 509 >ref|YP_006666125.1| ATP1 (mitochondrion) [Malus domestica] gi|401661928|emb|CBX33384.1| atp1 (mitochondrion) [Malus domestica] Length = 510 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 241 IDPELLKSFLEKGGLTNERKIELDAFLKESALPYL 137 + PELL+S LEKGGLTNERK+E D FLKESALPYL Sbjct: 475 VKPELLQSLLEKGGLTNERKMEPDTFLKESALPYL 509 >gb|ABY55213.1| Atp1 [Bambusa oldhamii] Length = 509 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 241 IDPELLKSFLEKGGLTNERKIELDAFLKESALPYL 137 I+PEL KSFLEKGGLTNERK+E DA LKE+ALPYL Sbjct: 475 INPELQKSFLEKGGLTNERKMEPDASLKETALPYL 509 >ref|YP_398393.1| atp1 [Triticum aestivum] gi|556927028|ref|YP_008757384.1| ATP synthase subunit 1 (mitochondrion) [Aegilops speltoides] gi|556927187|ref|YP_008758145.1| ATP synthase subunit 1 (mitochondrion) [Triticum timopheevii] gi|13725|emb|CAA34060.1| unnamed protein product [Triticum aestivum] gi|1405781|emb|CAA56641.1| ATP synthase subunit alpha [Triticum durum x Triticosecale sp.] gi|1430900|emb|CAA67492.1| atpA [Secale cereale] gi|78675233|dbj|BAE47658.1| atp1 [Triticum aestivum] gi|169649046|gb|ACA62607.1| apt1 [Triticum aestivum] gi|291498595|gb|ADE08069.1| apt1-1 [Triticum aestivum] gi|291498596|gb|ADE08070.1| apt1-2 [Triticum aestivum] gi|549067734|dbj|BAN94706.1| ATP synthase subunit 1 (mitochondrion) [Triticum timopheevii] gi|549067792|dbj|BAN94763.1| ATP synthase subunit 1 (mitochondrion) [Aegilops speltoides] gi|578888235|gb|AHI16340.1| atp1 (mitochondrion) [Aegilops longissima] gi|578888257|gb|AHI16361.1| atp1 (mitochondrion) [Triticum durum] gi|578888290|gb|AHI16393.1| atp1 (mitochondrion) [Triticum durum] Length = 509 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -3 Query: 241 IDPELLKSFLEKGGLTNERKIELDAFLKESALPYL 137 I+PEL KSFLEKGGLTNERK+E DA LKES LPYL Sbjct: 475 INPELQKSFLEKGGLTNERKMEPDASLKESTLPYL 509 >sp|P12862.1|ATPAM_WHEAT RecName: Full=ATP synthase subunit alpha, mitochondrial Length = 509 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -3 Query: 241 IDPELLKSFLEKGGLTNERKIELDAFLKESALPYL 137 I+PEL KSFLEKGGLTNERK+E DA LKES LPYL Sbjct: 475 INPELQKSFLEKGGLTNERKMEPDASLKESTLPYL 509 >gb|EMT32681.1| ATP synthase subunit alpha, mitochondrial [Aegilops tauschii] Length = 499 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -3 Query: 241 IDPELLKSFLEKGGLTNERKIELDAFLKESALPYL 137 I+PEL KSFLEKGGLTNERK+E DA LKES LPYL Sbjct: 465 INPELQKSFLEKGGLTNERKMEPDASLKESTLPYL 499 >gb|EMT32679.1| ATP synthase subunit alpha, mitochondrial [Aegilops tauschii] Length = 371 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -3 Query: 241 IDPELLKSFLEKGGLTNERKIELDAFLKESALPYL 137 I+PEL KSFLEKGGLTNERK+E DA LKES LPYL Sbjct: 337 INPELQKSFLEKGGLTNERKMEPDASLKESTLPYL 371 >gb|EMS53051.1| ATP synthase subunit alpha, mitochondrial [Triticum urartu] Length = 411 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -3 Query: 241 IDPELLKSFLEKGGLTNERKIELDAFLKESALPYL 137 I+PEL KSFLEKGGLTNERK+E DA LKES LPYL Sbjct: 377 INPELRKSFLEKGGLTNERKMEPDACLKESTLPYL 411 >gb|EMS52683.1| ATP synthase subunit alpha, mitochondrial [Triticum urartu] Length = 214 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -3 Query: 241 IDPELLKSFLEKGGLTNERKIELDAFLKESALPYL 137 I+PEL KSFLEKGGLTNERK+E DA LKES LPYL Sbjct: 180 INPELQKSFLEKGGLTNERKMEPDASLKESTLPYL 214