BLASTX nr result
ID: Zingiber23_contig00052145
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00052145 (287 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276470.2| PREDICTED: uncharacterized protein At5g41620... 57 3e-06 >ref|XP_002276470.2| PREDICTED: uncharacterized protein At5g41620-like [Vitis vinifera] Length = 648 Score = 57.0 bits (136), Expect = 3e-06 Identities = 34/75 (45%), Positives = 40/75 (53%), Gaps = 3/75 (4%) Frame = -1 Query: 287 GVKLRRGVAVEKKGGLCTPVPAWKLGAL---GXXXXXXXXXXXXXXSARKLGANLWENQD 117 G KL+RGV V K+GG CTP P W+LG SARKLGANLWE Q Sbjct: 2 GKKLKRGVLVGKRGGPCTPSPTWRLGFSLNDATSSIDKDLDCSTSVSARKLGANLWEIQS 61 Query: 116 LVPYAATSRRRDKLR 72 +P A +R +LR Sbjct: 62 HLPVANMNRGGGRLR 76