BLASTX nr result
ID: Zingiber23_contig00052045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00052045 (215 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW80409.1| hypothetical protein ZEAMMB73_318069, partial [Ze... 57 2e-06 gb|EEC70185.1| hypothetical protein OsI_00917 [Oryza sativa Indi... 56 6e-06 ref|NP_001042414.1| Os01g0218800 [Oryza sativa Japonica Group] g... 56 6e-06 ref|XP_002454931.1| hypothetical protein SORBIDRAFT_03g001640 [S... 55 7e-06 >gb|AFW80409.1| hypothetical protein ZEAMMB73_318069, partial [Zea mays] Length = 759 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -2 Query: 112 IMESNLAREGSDRKEDFYCPEDFVLGDIVWAKYGNKN 2 ++E REGSD+KEDFY PEDFVLGD+VWA+ G K+ Sbjct: 162 VVECKPKREGSDKKEDFYWPEDFVLGDVVWARSGKKS 198 >gb|EEC70185.1| hypothetical protein OsI_00917 [Oryza sativa Indica Group] Length = 991 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = -2 Query: 115 LIMESNLAREGSDRKEDFYCPEDFVLGDIVWAKYGNK 5 +++E REG D+KEDFY PEDFVLGD+VWA+ G K Sbjct: 167 VVVECKPKREGGDKKEDFYWPEDFVLGDVVWARSGKK 203 >ref|NP_001042414.1| Os01g0218800 [Oryza sativa Japonica Group] gi|56784088|dbj|BAD81417.1| putative trithorax 3 [Oryza sativa Japonica Group] gi|113531945|dbj|BAF04328.1| Os01g0218800 [Oryza sativa Japonica Group] Length = 991 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = -2 Query: 115 LIMESNLAREGSDRKEDFYCPEDFVLGDIVWAKYGNK 5 +++E REG D+KEDFY PEDFVLGD+VWA+ G K Sbjct: 167 VVVECKPKREGGDKKEDFYWPEDFVLGDVVWARSGKK 203 >ref|XP_002454931.1| hypothetical protein SORBIDRAFT_03g001640 [Sorghum bicolor] gi|241926906|gb|EES00051.1| hypothetical protein SORBIDRAFT_03g001640 [Sorghum bicolor] Length = 993 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = -2 Query: 115 LIMESNLAREGSDRKEDFYCPEDFVLGDIVWAKYGNKN 2 +++E RE SD+KEDFY PEDFVLGD+VWA+ G K+ Sbjct: 191 VVVECKPKREASDKKEDFYWPEDFVLGDVVWARSGKKS 228