BLASTX nr result
ID: Zingiber23_contig00051818
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00051818 (290 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004296063.1| PREDICTED: pentatricopeptide repeat-containi... 76 4e-12 ref|XP_004148701.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 ref|XP_006651199.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-11 gb|EOY11720.1| Pentatricopeptide repeat (PPR) superfamily protei... 74 2e-11 ref|XP_002983649.1| hypothetical protein SELMODRAFT_118721 [Sela... 74 2e-11 ref|XP_002990563.1| hypothetical protein SELMODRAFT_131869 [Sela... 74 2e-11 emb|CBI15662.3| unnamed protein product [Vitis vinifera] 74 2e-11 ref|XP_002468209.1| hypothetical protein SORBIDRAFT_01g041740 [S... 74 2e-11 ref|NP_001141725.1| hypothetical protein [Zea mays] gi|194705708... 74 2e-11 ref|XP_002280013.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-11 emb|CAN62482.1| hypothetical protein VITISV_010810 [Vitis vinifera] 74 2e-11 gb|EOY22476.1| Pentatricopeptide repeat superfamily protein [The... 74 3e-11 ref|XP_003520116.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 ref|XP_004231338.1| PREDICTED: pentatricopeptide repeat-containi... 73 3e-11 ref|XP_006487970.1| PREDICTED: pentatricopeptide repeat-containi... 73 4e-11 ref|XP_006477030.1| PREDICTED: pentatricopeptide repeat-containi... 73 4e-11 ref|XP_003588474.1| Pentatricopeptide repeat-containing protein ... 73 4e-11 gb|ESW35800.1| hypothetical protein PHAVU_001G265800g [Phaseolus... 72 6e-11 gb|ESW15249.1| hypothetical protein PHAVU_007G057100g [Phaseolus... 72 6e-11 ref|XP_006440110.1| hypothetical protein CICLE_v10019093mg [Citr... 72 6e-11 >ref|XP_004296063.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Fragaria vesca subsp. vesca] Length = 867 Score = 76.3 bits (186), Expect = 4e-12 Identities = 30/39 (76%), Positives = 37/39 (94%) Frame = +3 Query: 6 DCHTVMKLISLLTKRELIVRDANRFHHFKEGSCSCQDYW 122 DCHTV KLIS++T+RE+IVRD+NRFHHFK+G+CSC DYW Sbjct: 829 DCHTVTKLISVITEREIIVRDSNRFHHFKDGTCSCGDYW 867 >ref|XP_004148701.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Cucumis sativus] gi|449517215|ref|XP_004165641.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Cucumis sativus] Length = 706 Score = 74.7 bits (182), Expect = 1e-11 Identities = 27/39 (69%), Positives = 38/39 (97%) Frame = +3 Query: 6 DCHTVMKLISLLTKRELIVRDANRFHHFKEGSCSCQDYW 122 DCH+V+KLI+++TKRE+++RDA+RFHHF++GSCSC DYW Sbjct: 668 DCHSVIKLIAMITKREIVIRDASRFHHFRDGSCSCGDYW 706 >ref|XP_006651199.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170-like [Oryza brachyantha] Length = 637 Score = 74.3 bits (181), Expect = 2e-11 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = +3 Query: 6 DCHTVMKLISLLTKRELIVRDANRFHHFKEGSCSCQDYW 122 DCHT +KLIS + +RE+IVRD+NRFHHFK+GSCSC+DYW Sbjct: 599 DCHTAIKLISQMVQREIIVRDSNRFHHFKKGSCSCRDYW 637 >gb|EOY11720.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 [Theobroma cacao] gi|508719824|gb|EOY11721.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 [Theobroma cacao] Length = 731 Score = 74.3 bits (181), Expect = 2e-11 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = +3 Query: 6 DCHTVMKLISLLTKRELIVRDANRFHHFKEGSCSCQDYW 122 DCHT +KLI+ +TKRE+I+RDANRFHHFK+G CSC+DYW Sbjct: 693 DCHTAIKLIAKVTKREIILRDANRFHHFKDGFCSCRDYW 731 >ref|XP_002983649.1| hypothetical protein SELMODRAFT_118721 [Selaginella moellendorffii] gi|300148486|gb|EFJ15145.1| hypothetical protein SELMODRAFT_118721 [Selaginella moellendorffii] Length = 351 Score = 74.3 bits (181), Expect = 2e-11 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +3 Query: 6 DCHTVMKLISLLTKRELIVRDANRFHHFKEGSCSCQDYW 122 DCHTV K ISL+TKR ++VRD+NRFHHF +G CSCQDYW Sbjct: 313 DCHTVTKFISLVTKRRIVVRDSNRFHHFDDGRCSCQDYW 351 >ref|XP_002990563.1| hypothetical protein SELMODRAFT_131869 [Selaginella moellendorffii] gi|300141731|gb|EFJ08440.1| hypothetical protein SELMODRAFT_131869 [Selaginella moellendorffii] Length = 489 Score = 74.3 bits (181), Expect = 2e-11 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +3 Query: 6 DCHTVMKLISLLTKRELIVRDANRFHHFKEGSCSCQDYW 122 DCHTV K ISL+TKR ++VRD+NRFHHF +G CSCQDYW Sbjct: 451 DCHTVTKFISLVTKRRIVVRDSNRFHHFDDGRCSCQDYW 489 >emb|CBI15662.3| unnamed protein product [Vitis vinifera] Length = 657 Score = 73.9 bits (180), Expect = 2e-11 Identities = 28/39 (71%), Positives = 37/39 (94%) Frame = +3 Query: 6 DCHTVMKLISLLTKRELIVRDANRFHHFKEGSCSCQDYW 122 DCH+ +KLI+L+T+RE++VRDA+RFHHFK+GSCSC DYW Sbjct: 619 DCHSAIKLIALVTRREIVVRDASRFHHFKDGSCSCGDYW 657 >ref|XP_002468209.1| hypothetical protein SORBIDRAFT_01g041740 [Sorghum bicolor] gi|241922063|gb|EER95207.1| hypothetical protein SORBIDRAFT_01g041740 [Sorghum bicolor] Length = 635 Score = 73.9 bits (180), Expect = 2e-11 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +3 Query: 6 DCHTVMKLISLLTKRELIVRDANRFHHFKEGSCSCQDYW 122 DCHT +KLIS + +RE+IVRD+NRFHHFK GSCSC+DYW Sbjct: 597 DCHTTIKLISKIVQREIIVRDSNRFHHFKNGSCSCRDYW 635 >ref|NP_001141725.1| hypothetical protein [Zea mays] gi|194705708|gb|ACF86938.1| unknown [Zea mays] gi|413956425|gb|AFW89074.1| hypothetical protein ZEAMMB73_742653 [Zea mays] Length = 635 Score = 73.9 bits (180), Expect = 2e-11 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +3 Query: 6 DCHTVMKLISLLTKRELIVRDANRFHHFKEGSCSCQDYW 122 DCHT +KLIS + +RE+IVRD+NRFHHFK GSCSC+DYW Sbjct: 597 DCHTTIKLISKIVQREIIVRDSNRFHHFKNGSCSCRDYW 635 >ref|XP_002280013.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Vitis vinifera] Length = 704 Score = 73.9 bits (180), Expect = 2e-11 Identities = 28/39 (71%), Positives = 37/39 (94%) Frame = +3 Query: 6 DCHTVMKLISLLTKRELIVRDANRFHHFKEGSCSCQDYW 122 DCH+ +KLI+L+T+RE++VRDA+RFHHFK+GSCSC DYW Sbjct: 666 DCHSAIKLIALVTRREIVVRDASRFHHFKDGSCSCGDYW 704 >emb|CAN62482.1| hypothetical protein VITISV_010810 [Vitis vinifera] Length = 704 Score = 73.9 bits (180), Expect = 2e-11 Identities = 28/39 (71%), Positives = 37/39 (94%) Frame = +3 Query: 6 DCHTVMKLISLLTKRELIVRDANRFHHFKEGSCSCQDYW 122 DCH+ +KLI+L+T+RE++VRDA+RFHHFK+GSCSC DYW Sbjct: 666 DCHSAIKLIALVTRREIVVRDASRFHHFKDGSCSCGDYW 704 >gb|EOY22476.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] Length = 702 Score = 73.6 bits (179), Expect = 3e-11 Identities = 28/39 (71%), Positives = 36/39 (92%) Frame = +3 Query: 6 DCHTVMKLISLLTKRELIVRDANRFHHFKEGSCSCQDYW 122 DCH +KLI+L+T+RE++VRDA+RFHHFK+GSCSC DYW Sbjct: 664 DCHNAIKLIALVTRREIVVRDASRFHHFKDGSCSCGDYW 702 >ref|XP_003520116.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like isoform X1 [Glycine max] gi|571439750|ref|XP_006574948.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like isoform X2 [Glycine max] Length = 785 Score = 73.6 bits (179), Expect = 3e-11 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +3 Query: 6 DCHTVMKLISLLTKRELIVRDANRFHHFKEGSCSCQDYW 122 DCH+ ++ ISLL +RE+IVRDA RFHHFK+GSCSCQDYW Sbjct: 747 DCHSAIRYISLLVEREIIVRDATRFHHFKDGSCSCQDYW 785 >ref|XP_004231338.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Solanum lycopersicum] Length = 625 Score = 73.2 bits (178), Expect = 3e-11 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = +3 Query: 6 DCHTVMKLISLLTKRELIVRDANRFHHFKEGSCSCQDYW 122 DCHT +KL+S + +RE+IVRD NRFHHFK+GSCSC+DYW Sbjct: 587 DCHTAIKLVSKIYEREIIVRDVNRFHHFKDGSCSCRDYW 625 >ref|XP_006487970.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Citrus sinensis] Length = 873 Score = 72.8 bits (177), Expect = 4e-11 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +3 Query: 6 DCHTVMKLISLLTKRELIVRDANRFHHFKEGSCSCQDYW 122 DCHTV+KLIS L +R+++VRD NRFHHFKEG CSC DYW Sbjct: 835 DCHTVIKLISKLERRDIVVRDTNRFHHFKEGLCSCGDYW 873 >ref|XP_006477030.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Citrus sinensis] Length = 703 Score = 72.8 bits (177), Expect = 4e-11 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = +3 Query: 3 CDCHTVMKLISLLTKRELIVRDANRFHHFKEGSCSCQDYW 122 CDCH +KLI+++T RE++VRDA+RFHHFK+G CSC DYW Sbjct: 664 CDCHNAIKLIAMVTGREIVVRDASRFHHFKDGMCSCGDYW 703 >ref|XP_003588474.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355477522|gb|AES58725.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 668 Score = 72.8 bits (177), Expect = 4e-11 Identities = 27/39 (69%), Positives = 35/39 (89%) Frame = +3 Query: 6 DCHTVMKLISLLTKRELIVRDANRFHHFKEGSCSCQDYW 122 DCH+ +K +SL+ KRE+IVRD NRFHHF++GSCSC+DYW Sbjct: 630 DCHSAIKYVSLVVKREIIVRDTNRFHHFRDGSCSCRDYW 668 >gb|ESW35800.1| hypothetical protein PHAVU_001G265800g [Phaseolus vulgaris] Length = 611 Score = 72.4 bits (176), Expect = 6e-11 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +3 Query: 6 DCHTVMKLISLLTKRELIVRDANRFHHFKEGSCSCQDYW 122 DCHTV+KLIS +T RE+ VRDA R+HHFK+GSCSC D+W Sbjct: 573 DCHTVLKLISTITNREIYVRDAKRYHHFKDGSCSCHDFW 611 >gb|ESW15249.1| hypothetical protein PHAVU_007G057100g [Phaseolus vulgaris] Length = 786 Score = 72.4 bits (176), Expect = 6e-11 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +3 Query: 6 DCHTVMKLISLLTKRELIVRDANRFHHFKEGSCSCQDYW 122 DCH+ +K IS L KRE+IVRD RFHHFK+GSCSCQDYW Sbjct: 748 DCHSAIKYISKLVKREIIVRDTTRFHHFKDGSCSCQDYW 786 >ref|XP_006440110.1| hypothetical protein CICLE_v10019093mg [Citrus clementina] gi|557542372|gb|ESR53350.1| hypothetical protein CICLE_v10019093mg [Citrus clementina] Length = 703 Score = 72.4 bits (176), Expect = 6e-11 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = +3 Query: 3 CDCHTVMKLISLLTKRELIVRDANRFHHFKEGSCSCQDYW 122 CDCH +KLI+++T RE++VRDA+RFHHFK+G CSC DYW Sbjct: 664 CDCHNAIKLIAMVTGREIVVRDASRFHHFKDGICSCGDYW 703