BLASTX nr result
ID: Zingiber23_contig00051141
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00051141 (302 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510752.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 ref|XP_006390171.1| hypothetical protein EUTSA_v10019727mg [Eutr... 55 7e-06 >ref|XP_002510752.1| conserved hypothetical protein [Ricinus communis] gi|223551453|gb|EEF52939.1| conserved hypothetical protein [Ricinus communis] Length = 224 Score = 57.8 bits (138), Expect = 1e-06 Identities = 31/52 (59%), Positives = 37/52 (71%) Frame = +2 Query: 14 MRTTIDLGSHRGTGLYIIDTATDVDCTKDVRLGRRFFRSLIERVVPCCAVLP 169 MR IDLG+ RG+ L IIDT T VDC ++VR RR FRSL+E +VPCC P Sbjct: 1 MRMMIDLGNQRGS-LSIIDTPTSVDCGREVRF-RRSFRSLVECMVPCCGFQP 50 >ref|XP_006390171.1| hypothetical protein EUTSA_v10019727mg [Eutrema salsugineum] gi|557086605|gb|ESQ27457.1| hypothetical protein EUTSA_v10019727mg [Eutrema salsugineum] Length = 226 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = +2 Query: 14 MRTTIDLGSHRGTGLYIIDTATDVDCTKDVRLGRRFFRSLIERVVPCC 157 MRT +DLG R + L IID+ T+VDC ++V L RR RSLIE ++P C Sbjct: 1 MRTMVDLGRERSSNLRIIDSPTNVDCAREVGLRRRTLRSLIECLIPYC 48