BLASTX nr result
ID: Zingiber23_contig00049812
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00049812 (258 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|O82627.1|SSG1_ANTMA RecName: Full=Granule-bound starch syntha... 57 3e-06 ref|XP_004162962.1| PREDICTED: LOW QUALITY PROTEIN: granule-boun... 57 3e-06 ref|XP_004145874.1| PREDICTED: granule-bound starch synthase 1, ... 57 3e-06 ref|XP_002461889.1| hypothetical protein SORBIDRAFT_02g009870 [S... 56 4e-06 ref|XP_003569238.1| PREDICTED: granule-bound starch synthase 1b,... 55 9e-06 >sp|O82627.1|SSG1_ANTMA RecName: Full=Granule-bound starch synthase 1, chloroplastic/amyloplastic; AltName: Full=Granule-bound starch synthase I; Short=GBSS-I; Flags: Precursor gi|3688123|emb|CAA06958.1| granule-bound starch synthase [Antirrhinum majus] Length = 608 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 256 KFLLSLGVEGSEAGIDGEEIAPLAKENVATP 164 K LLSLGV GSE G+DGEEIAPLAKENVATP Sbjct: 578 KMLLSLGVSGSEPGVDGEEIAPLAKENVATP 608 >ref|XP_004162962.1| PREDICTED: LOW QUALITY PROTEIN: granule-bound starch synthase 1, chloroplastic/amyloplastic-like [Cucumis sativus] Length = 614 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 256 KFLLSLGVEGSEAGIDGEEIAPLAKENVATP 164 KFLL LGVE S+AGI+GEEIAPLAKENVATP Sbjct: 584 KFLLGLGVENSQAGIEGEEIAPLAKENVATP 614 >ref|XP_004145874.1| PREDICTED: granule-bound starch synthase 1, chloroplastic/amyloplastic-like [Cucumis sativus] Length = 614 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 256 KFLLSLGVEGSEAGIDGEEIAPLAKENVATP 164 KFLL LGVE S+AGI+GEEIAPLAKENVATP Sbjct: 584 KFLLGLGVENSQAGIEGEEIAPLAKENVATP 614 >ref|XP_002461889.1| hypothetical protein SORBIDRAFT_02g009870 [Sorghum bicolor] gi|145202756|gb|ABP35819.1| granule-bound starch synthase II precursor [Sorghum bicolor] gi|241925266|gb|EER98410.1| hypothetical protein SORBIDRAFT_02g009870 [Sorghum bicolor] Length = 607 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 250 LLSLGVEGSEAGIDGEEIAPLAKENVATP 164 LL LGVEGS+AGIDGEEIAPLAKENVATP Sbjct: 579 LLGLGVEGSQAGIDGEEIAPLAKENVATP 607 >ref|XP_003569238.1| PREDICTED: granule-bound starch synthase 1b, chloroplastic/amyloplastic-like [Brachypodium distachyon] Length = 604 Score = 55.1 bits (131), Expect = 9e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 250 LLSLGVEGSEAGIDGEEIAPLAKENVATP 164 LL LGVEGS+AGIDGEEIAPLAK+NVATP Sbjct: 576 LLGLGVEGSQAGIDGEEIAPLAKQNVATP 604