BLASTX nr result
ID: Zingiber23_contig00049803
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00049803 (373 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006305620.1| hypothetical protein CARUB_v10010307mg, part... 56 6e-06 >ref|XP_006305620.1| hypothetical protein CARUB_v10010307mg, partial [Capsella rubella] gi|482574331|gb|EOA38518.1| hypothetical protein CARUB_v10010307mg, partial [Capsella rubella] Length = 206 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/92 (32%), Positives = 40/92 (43%) Frame = +3 Query: 96 RKLHNFIFPTRSWGNQRHLRCTNLPFAGREDTGATLTLSFDRIGRTTGRCPPPSHLEKTS 275 ++LHNF P WG QR+LRC NLP + P P H S Sbjct: 34 KRLHNFPLPQLRWGQQRYLRCVNLPSSNSHHPS-----------------PSPDHPPNRS 76 Query: 276 PASTKGKANEGAERTLSSSVPDAERPWNLRKR 371 ++ G +N+ + + V A RPWNLR R Sbjct: 77 VSTIAGVSNDKLKEAKNGDVVAAARPWNLRTR 108