BLASTX nr result
ID: Zingiber23_contig00049794
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00049794 (535 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACF21695.1| NBS-type resistance protein RGC5 [Musa acuminata ... 55 1e-05 >gb|ACF21695.1| NBS-type resistance protein RGC5 [Musa acuminata subsp. malaccensis] Length = 1442 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/58 (51%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Frame = -3 Query: 533 GLLSQNLSNIEVIYVEGCNELMRMPLKRFENFTSLKELQIKACPKL-SLTQEEEAVLL 363 GLLS +L +I I + C EL+ +P+KRF FT+L+ L I+ CPKL S+TQ EE LL Sbjct: 1150 GLLSNHLPHINAIRIWECAELLWLPVKRFREFTTLENLSIRNCPKLMSMTQCEENDLL 1207