BLASTX nr result
ID: Zingiber23_contig00049762
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00049762 (269 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_010421912.1| ribonuclease H [Anaerophaga thermohalophila] 58 1e-06 ref|WP_002838806.1| RNase H [Finegoldia magna] gi|302311109|gb|E... 58 1e-06 ref|XP_001906541.1| hypothetical protein [Podospora anserina S m... 58 1e-06 ref|WP_002840596.1| RNase H [Finegoldia magna] gi|302493636|gb|E... 57 2e-06 ref|YP_001691703.1| ribonuclease H-like protein [Finegoldia magn... 57 2e-06 ref|WP_016776839.1| ribonuclease H [Anaerophaga thermohalophila] 55 7e-06 ref|WP_021123360.1| caulimovirus viroplasmin family protein [[Cl... 55 1e-05 ref|WP_021128677.1| RNase H family protein [[Clostridium] sordel... 55 1e-05 >ref|WP_010421912.1| ribonuclease H [Anaerophaga thermohalophila] Length = 209 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/58 (46%), Positives = 36/58 (62%) Frame = -1 Query: 269 VFVGRKPGIYETWVEASDHINGFKGVIHKSFKTREEAQKAYEE*FEKRSTPTSFASSP 96 +++G K GI + W E ING+KG +KSFKT EEAQKAYE + K + +SP Sbjct: 9 IWLGHKTGIVDNWEECKKRINGYKGAKYKSFKTLEEAQKAYESPWTKNISSNKKTTSP 66 >ref|WP_002838806.1| RNase H [Finegoldia magna] gi|302311109|gb|EFK93130.1| ribonuclease HI [Finegoldia magna ACS-171-V-Col3] Length = 202 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/42 (57%), Positives = 30/42 (71%) Frame = -1 Query: 269 VFVGRKPGIYETWVEASDHINGFKGVIHKSFKTREEAQKAYE 144 V +GR PGIY +W E + +NGFKG I+KSFKT+EEA E Sbjct: 7 VKIGRNPGIYNSWAECQEQVNGFKGAIYKSFKTKEEADNFIE 48 >ref|XP_001906541.1| hypothetical protein [Podospora anserina S mat+] gi|170941558|emb|CAP67210.1| unnamed protein product [Podospora anserina S mat+] Length = 334 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/57 (50%), Positives = 36/57 (63%) Frame = -1 Query: 269 VFVGRKPGIYETWVEASDHINGFKGVIHKSFKTREEAQKAYEE*FEKRSTPTSFASS 99 V VG+KPG+Y +W EASD + GF G IHKSF TR+EAQ + +T ASS Sbjct: 12 VRVGKKPGVYTSWDEASDQVIGFGGAIHKSFPTRKEAQDWFNAGRSSSNTTNQQASS 68 >ref|WP_002840596.1| RNase H [Finegoldia magna] gi|302493636|gb|EFL53424.1| ribonuclease HI [Finegoldia magna BVS033A4] Length = 202 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = -1 Query: 269 VFVGRKPGIYETWVEASDHINGFKGVIHKSFKTREEA 159 V +GR PGIY +W E + +NGFKG I+KSFKT+EEA Sbjct: 7 VKIGRNPGIYNSWAECQEQVNGFKGAIYKSFKTKEEA 43 >ref|YP_001691703.1| ribonuclease H-like protein [Finegoldia magna ATCC 29328] gi|488930132|ref|WP_002841207.1| RNase H [Finegoldia magna] gi|167830897|dbj|BAG07813.1| ribonuclease H-related protein [Finegoldia magna ATCC 29328] gi|341591056|gb|EGS34264.1| ribonuclease HI [Finegoldia magna SY403409CC001050417] Length = 202 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = -1 Query: 269 VFVGRKPGIYETWVEASDHINGFKGVIHKSFKTREEA 159 V +GR PGIY +W E + +NGFKG I+KSFKT+EEA Sbjct: 7 VKIGRNPGIYNSWAECQEQVNGFKGAIYKSFKTKEEA 43 >ref|WP_016776839.1| ribonuclease H [Anaerophaga thermohalophila] Length = 209 Score = 55.5 bits (132), Expect = 7e-06 Identities = 31/72 (43%), Positives = 41/72 (56%) Frame = -1 Query: 269 VFVGRKPGIYETWVEASDHINGFKGVIHKSFKTREEAQKAYEE*FEKRSTPTSFASSPNK 90 +++G K GI + W E ING+KG +KSFKT EEAQKAYE +P S S NK Sbjct: 9 IWLGHKTGIVDNWEECKKRINGYKGAKYKSFKTLEEAQKAYE-------SPWSENISSNK 61 Query: 89 ISCATLSSRSSS 54 + + S + S Sbjct: 62 KNTSQKSRKKIS 73 >ref|WP_021123360.1| caulimovirus viroplasmin family protein [[Clostridium] sordellii] gi|529074646|gb|EPZ58688.1| caulimovirus viroplasmin family protein [Clostridium sordellii ATCC 9714] Length = 61 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = -1 Query: 269 VFVGRKPGIYETWVEASDHINGFKGVIHKSFKTREEAQK 153 V VG+KPGIY+TW E + +N F G I+KSFKT EEA+K Sbjct: 8 VKVGKKPGIYKTWDECKEQVNKFPGAIYKSFKTLEEAEK 46 >ref|WP_021128677.1| RNase H family protein [[Clostridium] sordellii] gi|529073928|gb|EPZ57972.1| RNase H family protein [Clostridium sordellii VPI 9048] Length = 243 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = -1 Query: 269 VFVGRKPGIYETWVEASDHINGFKGVIHKSFKTREEAQK 153 V VG+KPGIY+TW E + +N F G I+KSFKT EEA+K Sbjct: 8 VKVGKKPGIYKTWDECKEQVNKFPGAIYKSFKTLEEAEK 46