BLASTX nr result
ID: Zingiber23_contig00049711
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00049711 (425 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525213.1| pentatricopeptide repeat-containing protein,... 56 6e-06 >ref|XP_002525213.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535510|gb|EEF37179.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 501 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/38 (60%), Positives = 31/38 (81%) Frame = +2 Query: 2 GYAWIEIGDKVHKFKAEDGSNAQLNEILRIVDCLACHM 115 GY+WIEI +KVH+F+AED SN ++ EIL ++DCL HM Sbjct: 445 GYSWIEIKNKVHRFRAEDRSNTRVGEILTVLDCLLDHM 482