BLASTX nr result
ID: Zingiber23_contig00049591
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00049591 (363 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006281597.1| hypothetical protein CARUB_v10027715mg, part... 79 8e-13 ref|XP_006413895.1| hypothetical protein EUTSA_v10024247mg [Eutr... 77 2e-12 dbj|BAB08822.1| unnamed protein product [Arabidopsis thaliana] 76 4e-12 ref|XP_006468593.1| PREDICTED: trichohyalin-like [Citrus sinensis] 76 4e-12 ref|XP_006448577.1| hypothetical protein CICLE_v10014128mg [Citr... 76 4e-12 ref|XP_004295531.1| PREDICTED: uncharacterized protein LOC101291... 76 4e-12 ref|XP_002530118.1| ubiquitin-protein ligase, putative [Ricinus ... 76 4e-12 gb|EOX96814.1| RING/U-box superfamily protein [Theobroma cacao] 76 5e-12 gb|EMJ15981.1| hypothetical protein PRUPE_ppa023579mg [Prunus pe... 75 9e-12 ref|XP_006364816.1| PREDICTED: uncharacterized protein LOC102594... 74 2e-11 ref|XP_004232606.1| PREDICTED: uncharacterized protein LOC101246... 74 2e-11 gb|EXB83239.1| Protein neuralized [Morus notabilis] 74 3e-11 ref|XP_003560178.1| PREDICTED: uncharacterized protein LOC100846... 72 6e-11 emb|CBI27383.3| unnamed protein product [Vitis vinifera] 71 2e-10 ref|XP_002264993.1| PREDICTED: uncharacterized protein LOC100253... 71 2e-10 ref|XP_006586938.1| PREDICTED: general transcriptional corepress... 70 4e-10 ref|XP_006658584.1| PREDICTED: uncharacterized protein LOC102703... 69 6e-10 gb|EMT20552.1| Neuralized-like protein 1A [Aegilops tauschii] 69 6e-10 ref|XP_004248512.1| PREDICTED: uncharacterized protein LOC101246... 68 1e-09 gb|ABK92731.1| unknown [Populus trichocarpa] 68 1e-09 >ref|XP_006281597.1| hypothetical protein CARUB_v10027715mg, partial [Capsella rubella] gi|482550301|gb|EOA14495.1| hypothetical protein CARUB_v10027715mg, partial [Capsella rubella] Length = 699 Score = 78.6 bits (192), Expect = 8e-13 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +1 Query: 1 LLYRCGHMCTCFNCAHQLQWSSAKCPICQAPIIDIVQTIPNS 126 LLYRCGHMCTC CAH+LQWS+ KCPIC+APIID+V+ NS Sbjct: 658 LLYRCGHMCTCLKCAHKLQWSTKKCPICKAPIIDVVRAFLNS 699 >ref|XP_006413895.1| hypothetical protein EUTSA_v10024247mg [Eutrema salsugineum] gi|557115065|gb|ESQ55348.1| hypothetical protein EUTSA_v10024247mg [Eutrema salsugineum] Length = 1207 Score = 77.4 bits (189), Expect = 2e-12 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +1 Query: 1 LLYRCGHMCTCFNCAHQLQWSSAKCPICQAPIIDIVQTIPNS 126 LLYRCGHMCTC CAH+LQWSS KCPIC API+D+V+ +S Sbjct: 1166 LLYRCGHMCTCLKCAHELQWSSKKCPICMAPIVDVVRAFLDS 1207 >dbj|BAB08822.1| unnamed protein product [Arabidopsis thaliana] Length = 684 Score = 76.3 bits (186), Expect = 4e-12 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +1 Query: 1 LLYRCGHMCTCFNCAHQLQWSSAKCPICQAPIIDIVQTIPNS 126 LLYRCGHMCTC CAH+LQWS+ KCPIC API+D+V+ +S Sbjct: 643 LLYRCGHMCTCLKCAHELQWSNMKCPICMAPIVDVVRAFLDS 684 >ref|XP_006468593.1| PREDICTED: trichohyalin-like [Citrus sinensis] Length = 1039 Score = 76.3 bits (186), Expect = 4e-12 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +1 Query: 1 LLYRCGHMCTCFNCAHQLQWSSAKCPICQAPIIDIVQTIPNS 126 LLYRCGHMCTC CAH+LQWSS KCPIC+API D+V+ +S Sbjct: 998 LLYRCGHMCTCLKCAHELQWSSGKCPICRAPIDDVVRAFMDS 1039 >ref|XP_006448577.1| hypothetical protein CICLE_v10014128mg [Citrus clementina] gi|557551188|gb|ESR61817.1| hypothetical protein CICLE_v10014128mg [Citrus clementina] Length = 1020 Score = 76.3 bits (186), Expect = 4e-12 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +1 Query: 1 LLYRCGHMCTCFNCAHQLQWSSAKCPICQAPIIDIVQTIPNS 126 LLYRCGHMCTC CAH+LQWSS KCPIC+API D+V+ +S Sbjct: 979 LLYRCGHMCTCLKCAHELQWSSGKCPICRAPIDDVVRAFMDS 1020 >ref|XP_004295531.1| PREDICTED: uncharacterized protein LOC101291707 [Fragaria vesca subsp. vesca] Length = 1280 Score = 76.3 bits (186), Expect = 4e-12 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +1 Query: 1 LLYRCGHMCTCFNCAHQLQWSSAKCPICQAPIIDIVQTIPNS 126 LLYRCGHMCTC CAH LQW+S KCPICQAPI D+V+ +S Sbjct: 1239 LLYRCGHMCTCLKCAHDLQWNSGKCPICQAPIADVVRAYMDS 1280 >ref|XP_002530118.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223530372|gb|EEF32262.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 740 Score = 76.3 bits (186), Expect = 4e-12 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +1 Query: 4 LYRCGHMCTCFNCAHQLQWSSAKCPICQAPIIDIVQTIPNS 126 LYRCGHMCTC CAH+LQWSS KCPIC+API+D+V+ +S Sbjct: 700 LYRCGHMCTCLKCAHELQWSSGKCPICRAPILDVVRAYMDS 740 >gb|EOX96814.1| RING/U-box superfamily protein [Theobroma cacao] Length = 966 Score = 75.9 bits (185), Expect = 5e-12 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +1 Query: 1 LLYRCGHMCTCFNCAHQLQWSSAKCPICQAPIIDIVQTIPN 123 LLYRCGHMCTC CAH+LQWS KCPIC+API+D+V P+ Sbjct: 908 LLYRCGHMCTCLKCAHELQWSGGKCPICRAPILDVVAYQPS 948 >gb|EMJ15981.1| hypothetical protein PRUPE_ppa023579mg [Prunus persica] Length = 1030 Score = 75.1 bits (183), Expect = 9e-12 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = +1 Query: 1 LLYRCGHMCTCFNCAHQLQWSSAKCPICQAPIIDIVQ 111 LLYRCGHMCTC CAH+LQW++ KCPIC+API+D+V+ Sbjct: 989 LLYRCGHMCTCLKCAHELQWNNGKCPICRAPIVDVVR 1025 >ref|XP_006364816.1| PREDICTED: uncharacterized protein LOC102594196 [Solanum tuberosum] Length = 1101 Score = 73.9 bits (180), Expect = 2e-11 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +1 Query: 1 LLYRCGHMCTCFNCAHQLQWSSAKCPICQAPIIDIVQTIPNS 126 LLYRCGHMCTCF CAH+L W + KCPIC+ PIID+V+ +S Sbjct: 1060 LLYRCGHMCTCFRCAHELLWGTGKCPICETPIIDVVRAYIHS 1101 >ref|XP_004232606.1| PREDICTED: uncharacterized protein LOC101246588 [Solanum lycopersicum] Length = 1078 Score = 73.9 bits (180), Expect = 2e-11 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +1 Query: 1 LLYRCGHMCTCFNCAHQLQWSSAKCPICQAPIIDIVQTIPNS 126 LLYRCGHMCTCF CAH+L W + KCPIC+ PIID+V+ +S Sbjct: 1037 LLYRCGHMCTCFRCAHELLWGTGKCPICETPIIDVVRAYIHS 1078 >gb|EXB83239.1| Protein neuralized [Morus notabilis] Length = 941 Score = 73.6 bits (179), Expect = 3e-11 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +1 Query: 1 LLYRCGHMCTCFNCAHQLQWSSAKCPICQAPIIDIVQ 111 LLYRCGHMCTC CAH+LQW+S KCP+C+API D+V+ Sbjct: 898 LLYRCGHMCTCLKCAHELQWNSGKCPMCRAPIADVVR 934 >ref|XP_003560178.1| PREDICTED: uncharacterized protein LOC100846253 [Brachypodium distachyon] Length = 733 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +1 Query: 1 LLYRCGHMCTCFNCAHQLQWSSAKCPICQAPIIDIVQTIPN 123 LLYRCGHMCTCFNCA QL+ SS CPICQ+PI D+V+ PN Sbjct: 692 LLYRCGHMCTCFNCADQLKSSSRSCPICQSPIDDVVRAHPN 732 >emb|CBI27383.3| unnamed protein product [Vitis vinifera] Length = 753 Score = 70.9 bits (172), Expect = 2e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 1 LLYRCGHMCTCFNCAHQLQWSSAKCPICQAPIIDIVQ 111 LLYRCGHMCTC CAH+LQ S+ KCPICQA I+D+VQ Sbjct: 712 LLYRCGHMCTCLKCAHELQSSTGKCPICQASIVDVVQ 748 >ref|XP_002264993.1| PREDICTED: uncharacterized protein LOC100253105 [Vitis vinifera] Length = 790 Score = 70.9 bits (172), Expect = 2e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 1 LLYRCGHMCTCFNCAHQLQWSSAKCPICQAPIIDIVQ 111 LLYRCGHMCTC CAH+LQ S+ KCPICQA I+D+VQ Sbjct: 749 LLYRCGHMCTCLKCAHELQSSTGKCPICQASIVDVVQ 785 >ref|XP_006586938.1| PREDICTED: general transcriptional corepressor trfA-like [Glycine max] Length = 922 Score = 69.7 bits (169), Expect = 4e-10 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = +1 Query: 1 LLYRCGHMCTCFNCAHQLQWSSAKCPICQAPIIDIVQTIPNS 126 +LYRCGHMCTC CA++LQW+S KCPIC+A I+D+V +S Sbjct: 881 VLYRCGHMCTCLKCANELQWNSGKCPICRAKIVDVVHVYVDS 922 >ref|XP_006658584.1| PREDICTED: uncharacterized protein LOC102703050, partial [Oryza brachyantha] Length = 521 Score = 68.9 bits (167), Expect = 6e-10 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +1 Query: 1 LLYRCGHMCTCFNCAHQLQWSSAKCPICQAPIIDIVQTIPN 123 LLYRCGHMCTCFNCA QL+ SS CPICQ+PI D+V+ N Sbjct: 480 LLYRCGHMCTCFNCADQLKSSSRSCPICQSPIEDVVRAHMN 520 >gb|EMT20552.1| Neuralized-like protein 1A [Aegilops tauschii] Length = 506 Score = 68.9 bits (167), Expect = 6e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 1 LLYRCGHMCTCFNCAHQLQWSSAKCPICQAPIIDIVQ 111 LLYRCGHMCTCFNCA QL+ SS CPICQ+PI D+V+ Sbjct: 465 LLYRCGHMCTCFNCADQLKSSSGSCPICQSPIDDVVR 501 >ref|XP_004248512.1| PREDICTED: uncharacterized protein LOC101246285 [Solanum lycopersicum] Length = 984 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +1 Query: 1 LLYRCGHMCTCFNCAHQLQWSSAKCPICQAPIIDIVQTIPNS 126 LLYRCGHMCTCF CAH+L KCPICQAPI+D+V+ +S Sbjct: 943 LLYRCGHMCTCFLCAHELISGIGKCPICQAPIMDVVRAYAHS 984 >gb|ABK92731.1| unknown [Populus trichocarpa] Length = 116 Score = 68.2 bits (165), Expect = 1e-09 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +1 Query: 4 LYRCGHMCTCFNCAHQLQWSSAKCPICQAPIIDIVQTIPNS 126 LYRCGHMCTC CAH+L SS KCPIC+API+D+V+ +S Sbjct: 76 LYRCGHMCTCLKCAHELLQSSGKCPICRAPILDVVRAYLDS 116