BLASTX nr result
ID: Zingiber23_contig00048241
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00048241 (272 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003533606.2| PREDICTED: probable disease resistance prote... 56 6e-06 >ref|XP_003533606.2| PREDICTED: probable disease resistance protein At5g63020-like [Glycine max] Length = 901 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/90 (34%), Positives = 46/90 (51%), Gaps = 1/90 (1%) Frame = -2 Query: 271 VLKVSNCGEMEELINC-VGSSANXXXXXXXXXXXXXXXLNCIARQPLTFPYLEQLYVSSC 95 +L++ NC +EE+I G + N L I Q L FP L+++ V+ C Sbjct: 786 LLRLYNCPSLEEVIGEEFGHAVNVFSSLEIVDLDSLPKLRSICSQVLRFPCLKEICVADC 845 Query: 94 PELRKLPFGAEICQNKLKGIFCQEDWWENI 5 P L KLPF + +N LK I Q++WW N+ Sbjct: 846 PRLLKLPFDSSSARNSLKHINGQKNWWRNL 875