BLASTX nr result
ID: Zingiber23_contig00047389
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00047389 (254 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW89736.1| putative leucine-rich repeat transmembrane protei... 57 3e-06 ref|XP_006477322.1| PREDICTED: probable LRR receptor-like serine... 55 1e-05 ref|XP_006440456.1| hypothetical protein CICLE_v10018802mg [Citr... 55 1e-05 >gb|AFW89736.1| putative leucine-rich repeat transmembrane protein kinase family protein [Zea mays] Length = 912 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/55 (52%), Positives = 30/55 (54%) Frame = +2 Query: 89 RLCLXXXXXALFFSSTGEAQTAADAEREVLLEFKGNVTADPGGALASWVVGGDPC 253 RL L L A A DAER LL+FK VTADPGG LASW GDPC Sbjct: 14 RLLLLLLLLLLLHCQCHRAGAATDAERRALLDFKAAVTADPGGVLASWTPTGDPC 68 >ref|XP_006477322.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g12460-like [Citrus sinensis] Length = 884 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/45 (51%), Positives = 32/45 (71%) Frame = +2 Query: 119 LFFSSTGEAQTAADAEREVLLEFKGNVTADPGGALASWVVGGDPC 253 L F+S G + +A ++E+LL+FKGN+T DP LASWV G+PC Sbjct: 16 LIFTSLGVSSASAATDKEILLQFKGNITDDPHNKLASWVSSGNPC 60 >ref|XP_006440456.1| hypothetical protein CICLE_v10018802mg [Citrus clementina] gi|557542718|gb|ESR53696.1| hypothetical protein CICLE_v10018802mg [Citrus clementina] Length = 884 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/45 (51%), Positives = 32/45 (71%) Frame = +2 Query: 119 LFFSSTGEAQTAADAEREVLLEFKGNVTADPGGALASWVVGGDPC 253 L F+S G + +A ++E+LL+FKGN+T DP LASWV G+PC Sbjct: 16 LIFTSLGVSSASAATDKEILLQFKGNITDDPHNKLASWVSSGNPC 60