BLASTX nr result
ID: Zingiber23_contig00047282
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00047282 (232 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529315.1| DNA binding protein, putative [Ricinus commu... 55 1e-05 >ref|XP_002529315.1| DNA binding protein, putative [Ricinus communis] gi|223531239|gb|EEF33084.1| DNA binding protein, putative [Ricinus communis] Length = 301 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -3 Query: 188 LLAAGPLMIVAATFTNATYERLPLPDDDTEAAAG 87 L+AAGP+M++AATF NATYERLPL DD+ A+AG Sbjct: 207 LIAAGPVMVIAATFANATYERLPLEDDEEAASAG 240