BLASTX nr result
ID: Zingiber23_contig00047127
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00047127 (687 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY07547.1| DNA binding with one finger 2.4, putative [Theobr... 56 9e-06 >gb|EOY07547.1| DNA binding with one finger 2.4, putative [Theobroma cacao] Length = 348 Score = 56.2 bits (134), Expect = 9e-06 Identities = 35/67 (52%), Positives = 40/67 (59%), Gaps = 8/67 (11%) Frame = +1 Query: 190 SMSGLYHFTGEARQVDGAKAVSG--------SSLITQLASVKMEDHNDQLRLNLSRQYLG 345 S SGLY F + G +G SS TQLASVKMED+N Q LNLSRQ+LG Sbjct: 262 SSSGLYQFESGGVEPSGYGGGAGHQVRPKISSSSATQLASVKMEDNNQQ-ELNLSRQFLG 320 Query: 346 LSGNDQY 366 + GNDQY Sbjct: 321 VPGNDQY 327