BLASTX nr result
ID: Zingiber23_contig00047094
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00047094 (255 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAM64847.1| hypothetical protein [Beta vulgaris] 55 1e-05 >dbj|BAM64847.1| hypothetical protein [Beta vulgaris] Length = 891 Score = 55.1 bits (131), Expect = 1e-05 Identities = 37/107 (34%), Positives = 49/107 (45%), Gaps = 26/107 (24%) Frame = +3 Query: 6 ETSVALFLRKTLRAVLSSRIPRLRP----------GPRPSADRRFLLDLGDLPAPIEH-- 149 E +A FL K L +L SRIP L+P D+ F L LGD PA +E Sbjct: 136 EQIIAQFLLKALHIILESRIPSLKPQDHSGDLLSNSKAKKTDKWFNLALGDRPAALEKLQ 195 Query: 150 --HGTFSDPLVVDILLTPRGED------------AEAGPCESVVERW 248 H DP+V+D+++ RG D E G E+V+ERW Sbjct: 196 FWHRNLMDPMVIDVIVIRRGLDDSSGNDLYYEQIFEGGAVETVIERW 242