BLASTX nr result
ID: Zingiber23_contig00046888
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00046888 (518 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002453620.1| hypothetical protein SORBIDRAFT_04g009100 [S... 56 4e-06 >ref|XP_002453620.1| hypothetical protein SORBIDRAFT_04g009100 [Sorghum bicolor] gi|241933451|gb|EES06596.1| hypothetical protein SORBIDRAFT_04g009100 [Sorghum bicolor] Length = 1034 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = +3 Query: 3 LVYEYMENGSRDQWLH*RRARSDSEHNEPFNWPKRLGIVI 122 LVYEYMENGS D+WLH RRA + SE P +WP RLG+ I Sbjct: 800 LVYEYMENGSLDRWLH-RRAAAASEAEPPLDWPTRLGVAI 838