BLASTX nr result
ID: Zingiber23_contig00046699
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00046699 (417 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006385188.1| auxin response factor 1 family protein [Popu... 59 5e-07 ref|XP_002331079.1| predicted protein [Populus trichocarpa] 59 5e-07 emb|CBA11999.1| putative auxin response factor 1 [Illicium parvi... 58 1e-06 ref|XP_006392241.1| hypothetical protein EUTSA_v10023326mg [Eutr... 57 3e-06 gb|AFD01315.1| auxin response factor 18-1 [Brassica rapa subsp. ... 56 4e-06 gb|EPS68815.1| auxin response factor 1 [Genlisea aurea] 55 7e-06 >ref|XP_006385188.1| auxin response factor 1 family protein [Populus trichocarpa] gi|550342079|gb|ERP62985.1| auxin response factor 1 family protein [Populus trichocarpa] Length = 660 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 106 HDSGCFQDVMYTELWKACAGPMVTLPCVGERVYYF 2 H GC D +Y ELW ACAGP+VTLPC GERVYYF Sbjct: 10 HPGGC-NDALYKELWHACAGPLVTLPCEGERVYYF 43 >ref|XP_002331079.1| predicted protein [Populus trichocarpa] Length = 660 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 106 HDSGCFQDVMYTELWKACAGPMVTLPCVGERVYYF 2 H GC D +Y ELW ACAGP+VTLPC GERVYYF Sbjct: 10 HPGGC-NDALYKELWHACAGPLVTLPCEGERVYYF 43 >emb|CBA11999.1| putative auxin response factor 1 [Illicium parviflorum] Length = 684 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/47 (53%), Positives = 34/47 (72%) Frame = -3 Query: 142 MSLMPPSRSTSSHDSGCFQDVMYTELWKACAGPMVTLPCVGERVYYF 2 M+L P + S+ + S ++D +Y ELW ACAGP+VT+P GERVYYF Sbjct: 1 MALAPSTPSSGALGSVAYKDALYQELWHACAGPLVTVPREGERVYYF 47 >ref|XP_006392241.1| hypothetical protein EUTSA_v10023326mg [Eutrema salsugineum] gi|567129362|ref|XP_006392242.1| hypothetical protein EUTSA_v10023326mg [Eutrema salsugineum] gi|557088747|gb|ESQ29527.1| hypothetical protein EUTSA_v10023326mg [Eutrema salsugineum] gi|557088748|gb|ESQ29528.1| hypothetical protein EUTSA_v10023326mg [Eutrema salsugineum] Length = 667 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/46 (56%), Positives = 29/46 (63%) Frame = -3 Query: 139 SLMPPSRSTSSHDSGCFQDVMYTELWKACAGPMVTLPCVGERVYYF 2 S M S +S G D +Y ELW ACAGP+VTLP GERVYYF Sbjct: 3 SQMAASNHSSGKPGGVLSDALYRELWHACAGPLVTLPREGERVYYF 48 >gb|AFD01315.1| auxin response factor 18-1 [Brassica rapa subsp. pekinensis] Length = 1055 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -3 Query: 118 STSSHDSGCFQDVMYTELWKACAGPMVTLPCVGERVYYF 2 S SS S +QD +YTELWKACAGP+V +P VGERV+YF Sbjct: 9 SRSSFPSS-YQDQLYTELWKACAGPLVEVPLVGERVFYF 46 >gb|EPS68815.1| auxin response factor 1 [Genlisea aurea] Length = 428 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/47 (51%), Positives = 31/47 (65%) Frame = -3 Query: 142 MSLMPPSRSTSSHDSGCFQDVMYTELWKACAGPMVTLPCVGERVYYF 2 M+L+P S +G D +Y ELW ACAGP+V++P GERVYYF Sbjct: 1 MALIPTSSLCGGRQTGPANDALYRELWHACAGPLVSVPHEGERVYYF 47