BLASTX nr result
ID: Zingiber23_contig00046531
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00046531 (233 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003571303.1| PREDICTED: probable pre-mRNA-splicing factor... 80 3e-13 ref|XP_006648562.1| PREDICTED: probable pre-mRNA-splicing factor... 79 6e-13 dbj|BAD23339.1| putative RNA helicase [Oryza sativa Japonica Group] 79 6e-13 gb|EEE56791.1| hypothetical protein OsJ_06373 [Oryza sativa Japo... 79 6e-13 gb|EAY85485.1| hypothetical protein OsI_06862 [Oryza sativa Indi... 79 6e-13 ref|NP_001046623.1| Os02g0301500 [Oryza sativa Japonica Group] g... 79 6e-13 ref|XP_006374312.1| ATP-dependent RNA helicase family protein [P... 78 1e-12 ref|XP_004498154.1| PREDICTED: probable pre-mRNA-splicing factor... 78 1e-12 ref|XP_006290254.1| hypothetical protein CARUB_v10016599mg [Caps... 78 1e-12 ref|XP_004156439.1| PREDICTED: probable pre-mRNA-splicing factor... 78 1e-12 ref|XP_004139208.1| PREDICTED: uncharacterized protein LOC101216... 78 1e-12 ref|NP_189288.1| probable pre-mRNA-splicing factor ATP-dependent... 78 1e-12 ref|XP_002876982.1| hypothetical protein ARALYDRAFT_347015 [Arab... 78 1e-12 ref|XP_002331832.1| predicted protein [Populus trichocarpa] 78 1e-12 dbj|BAE99056.1| putative ATP-dependent RNA helicase [Arabidopsis... 78 1e-12 dbj|BAD94695.1| ATP-dependent RNA helicase [Arabidopsis thaliana] 78 1e-12 emb|CAA66825.1| RNA helicase [Arabidopsis thaliana] gi|1495271|e... 78 1e-12 ref|XP_004952308.1| PREDICTED: probable pre-mRNA-splicing factor... 78 1e-12 gb|EMT13929.1| Putative pre-mRNA-splicing factor ATP-dependent R... 78 1e-12 gb|AFW70820.1| putative RNA helicase family protein [Zea mays] 78 1e-12 >ref|XP_003571303.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like [Brachypodium distachyon] Length = 1249 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 232 LAPRFYKTSDPTKMSKRKRQERIEPLYDRYHEPNSW 125 LAPRFYK+SDPTKMSKRKRQERIEPLYDRYHEPNSW Sbjct: 1207 LAPRFYKSSDPTKMSKRKRQERIEPLYDRYHEPNSW 1242 >ref|XP_006648562.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like [Oryza brachyantha] Length = 1187 Score = 79.0 bits (193), Expect = 6e-13 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 232 LAPRFYKTSDPTKMSKRKRQERIEPLYDRYHEPNSW 125 LAPRFYK++DPTKMSKRKRQERIEPLYDRYHEPNSW Sbjct: 1145 LAPRFYKSADPTKMSKRKRQERIEPLYDRYHEPNSW 1180 >dbj|BAD23339.1| putative RNA helicase [Oryza sativa Japonica Group] Length = 1240 Score = 79.0 bits (193), Expect = 6e-13 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 232 LAPRFYKTSDPTKMSKRKRQERIEPLYDRYHEPNSW 125 LAPRFYK++DPTKMSKRKRQERIEPLYDRYHEPNSW Sbjct: 1198 LAPRFYKSADPTKMSKRKRQERIEPLYDRYHEPNSW 1233 >gb|EEE56791.1| hypothetical protein OsJ_06373 [Oryza sativa Japonica Group] Length = 133 Score = 79.0 bits (193), Expect = 6e-13 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 232 LAPRFYKTSDPTKMSKRKRQERIEPLYDRYHEPNSW 125 LAPRFYK++DPTKMSKRKRQERIEPLYDRYHEPNSW Sbjct: 91 LAPRFYKSADPTKMSKRKRQERIEPLYDRYHEPNSW 126 >gb|EAY85485.1| hypothetical protein OsI_06862 [Oryza sativa Indica Group] Length = 1240 Score = 79.0 bits (193), Expect = 6e-13 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 232 LAPRFYKTSDPTKMSKRKRQERIEPLYDRYHEPNSW 125 LAPRFYK++DPTKMSKRKRQERIEPLYDRYHEPNSW Sbjct: 1198 LAPRFYKSADPTKMSKRKRQERIEPLYDRYHEPNSW 1233 >ref|NP_001046623.1| Os02g0301500 [Oryza sativa Japonica Group] gi|113536154|dbj|BAF08537.1| Os02g0301500, partial [Oryza sativa Japonica Group] Length = 546 Score = 79.0 bits (193), Expect = 6e-13 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 232 LAPRFYKTSDPTKMSKRKRQERIEPLYDRYHEPNSW 125 LAPRFYK++DPTKMSKRKRQERIEPLYDRYHEPNSW Sbjct: 504 LAPRFYKSADPTKMSKRKRQERIEPLYDRYHEPNSW 539 >ref|XP_006374312.1| ATP-dependent RNA helicase family protein [Populus trichocarpa] gi|550322071|gb|ERP52109.1| ATP-dependent RNA helicase family protein [Populus trichocarpa] Length = 1177 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 232 LAPRFYKTSDPTKMSKRKRQERIEPLYDRYHEPNSW 125 LAPRF+K SDPTKMSKRKRQERIEPLYDRYHEPNSW Sbjct: 1135 LAPRFFKVSDPTKMSKRKRQERIEPLYDRYHEPNSW 1170 >ref|XP_004498154.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like isoform X1 [Cicer arietinum] gi|502123536|ref|XP_004498155.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like isoform X2 [Cicer arietinum] gi|502123538|ref|XP_004498156.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like isoform X3 [Cicer arietinum] gi|502123540|ref|XP_004498157.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like isoform X4 [Cicer arietinum] gi|502123542|ref|XP_004498158.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like isoform X5 [Cicer arietinum] gi|502123544|ref|XP_004498159.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like isoform X6 [Cicer arietinum] gi|502123546|ref|XP_004498160.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like isoform X7 [Cicer arietinum] gi|502123548|ref|XP_004498161.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like isoform X8 [Cicer arietinum] Length = 1178 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 232 LAPRFYKTSDPTKMSKRKRQERIEPLYDRYHEPNSW 125 LAPRF+K SDPTKMSKRKRQERIEPLYDRYHEPNSW Sbjct: 1136 LAPRFFKVSDPTKMSKRKRQERIEPLYDRYHEPNSW 1171 >ref|XP_006290254.1| hypothetical protein CARUB_v10016599mg [Capsella rubella] gi|482558961|gb|EOA23152.1| hypothetical protein CARUB_v10016599mg [Capsella rubella] Length = 1174 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 232 LAPRFYKTSDPTKMSKRKRQERIEPLYDRYHEPNSW 125 LAPRF+K SDPTKMSKRKRQERIEPLYDRYHEPNSW Sbjct: 1132 LAPRFFKVSDPTKMSKRKRQERIEPLYDRYHEPNSW 1167 >ref|XP_004156439.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like [Cucumis sativus] Length = 1181 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 232 LAPRFYKTSDPTKMSKRKRQERIEPLYDRYHEPNSW 125 LAPRF+K SDPTKMSKRKRQERIEPLYDRYHEPNSW Sbjct: 1139 LAPRFFKVSDPTKMSKRKRQERIEPLYDRYHEPNSW 1174 >ref|XP_004139208.1| PREDICTED: uncharacterized protein LOC101216792 [Cucumis sativus] Length = 1218 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 232 LAPRFYKTSDPTKMSKRKRQERIEPLYDRYHEPNSW 125 LAPRF+K SDPTKMSKRKRQERIEPLYDRYHEPNSW Sbjct: 1176 LAPRFFKVSDPTKMSKRKRQERIEPLYDRYHEPNSW 1211 >ref|NP_189288.1| probable pre-mRNA-splicing factor ATP-dependent RNA helicase [Arabidopsis thaliana] gi|27735187|sp|Q38953.2|DHX8_ARATH RecName: Full=Probable pre-mRNA-splicing factor ATP-dependent RNA helicase gi|9293935|dbj|BAB01838.1| pre-mRNA splicing factor ATP-dependent RNA helicase-like protein [Arabidopsis thaliana] gi|332643657|gb|AEE77178.1| probable pre-mRNA-splicing factor ATP-dependent RNA helicase [Arabidopsis thaliana] Length = 1168 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 232 LAPRFYKTSDPTKMSKRKRQERIEPLYDRYHEPNSW 125 LAPRF+K SDPTKMSKRKRQERIEPLYDRYHEPNSW Sbjct: 1126 LAPRFFKVSDPTKMSKRKRQERIEPLYDRYHEPNSW 1161 >ref|XP_002876982.1| hypothetical protein ARALYDRAFT_347015 [Arabidopsis lyrata subsp. lyrata] gi|297322820|gb|EFH53241.1| hypothetical protein ARALYDRAFT_347015 [Arabidopsis lyrata subsp. lyrata] Length = 275 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 232 LAPRFYKTSDPTKMSKRKRQERIEPLYDRYHEPNSW 125 LAPRF+K SDPTKMSKRKRQERIEPLYDRYHEPNSW Sbjct: 233 LAPRFFKVSDPTKMSKRKRQERIEPLYDRYHEPNSW 268 >ref|XP_002331832.1| predicted protein [Populus trichocarpa] Length = 1171 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 232 LAPRFYKTSDPTKMSKRKRQERIEPLYDRYHEPNSW 125 LAPRF+K SDPTKMSKRKRQERIEPLYDRYHEPNSW Sbjct: 1129 LAPRFFKVSDPTKMSKRKRQERIEPLYDRYHEPNSW 1164 >dbj|BAE99056.1| putative ATP-dependent RNA helicase [Arabidopsis thaliana] Length = 603 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 232 LAPRFYKTSDPTKMSKRKRQERIEPLYDRYHEPNSW 125 LAPRF+K SDPTKMSKRKRQERIEPLYDRYHEPNSW Sbjct: 561 LAPRFFKVSDPTKMSKRKRQERIEPLYDRYHEPNSW 596 >dbj|BAD94695.1| ATP-dependent RNA helicase [Arabidopsis thaliana] Length = 273 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 232 LAPRFYKTSDPTKMSKRKRQERIEPLYDRYHEPNSW 125 LAPRF+K SDPTKMSKRKRQERIEPLYDRYHEPNSW Sbjct: 231 LAPRFFKVSDPTKMSKRKRQERIEPLYDRYHEPNSW 266 >emb|CAA66825.1| RNA helicase [Arabidopsis thaliana] gi|1495271|emb|CAA66613.1| RNA helicase [Arabidopsis thaliana] Length = 1121 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 232 LAPRFYKTSDPTKMSKRKRQERIEPLYDRYHEPNSW 125 LAPRF+K SDPTKMSKRKRQERIEPLYDRYHEPNSW Sbjct: 1079 LAPRFFKVSDPTKMSKRKRQERIEPLYDRYHEPNSW 1114 >ref|XP_004952308.1| PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase-like [Setaria italica] Length = 1222 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 232 LAPRFYKTSDPTKMSKRKRQERIEPLYDRYHEPNSW 125 LAPRFYK +DPTKMSKRKRQERIEPLYDRYHEPNSW Sbjct: 1180 LAPRFYKGADPTKMSKRKRQERIEPLYDRYHEPNSW 1215 >gb|EMT13929.1| Putative pre-mRNA-splicing factor ATP-dependent RNA helicase [Aegilops tauschii] Length = 1289 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 232 LAPRFYKTSDPTKMSKRKRQERIEPLYDRYHEPNSW 125 LAPRFYK +DPTKMSKRKRQERIEPLYDRYHEPNSW Sbjct: 1247 LAPRFYKGADPTKMSKRKRQERIEPLYDRYHEPNSW 1282 >gb|AFW70820.1| putative RNA helicase family protein [Zea mays] Length = 1236 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 232 LAPRFYKTSDPTKMSKRKRQERIEPLYDRYHEPNSW 125 LAPRFYK +DPTKMSKRKRQERIEPLYDRYHEPNSW Sbjct: 1194 LAPRFYKGADPTKMSKRKRQERIEPLYDRYHEPNSW 1229