BLASTX nr result
ID: Zingiber23_contig00046448
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00046448 (251 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530081.1| conserved hypothetical protein [Ricinus comm... 55 1e-05 >ref|XP_002530081.1| conserved hypothetical protein [Ricinus communis] gi|223530392|gb|EEF32280.1| conserved hypothetical protein [Ricinus communis] Length = 797 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +3 Query: 42 MDITNEAAVDAFSIGPSTVLGRAIALRVLLCGSF 143 MDI+NEA+VD FSIGPST++GR IA RVL C SF Sbjct: 1 MDISNEASVDPFSIGPSTIIGRTIAFRVLFCKSF 34