BLASTX nr result
ID: Zingiber23_contig00045679
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00045679 (250 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004306964.1| PREDICTED: CCR4-NOT transcription complex su... 59 9e-07 ref|XP_006445336.1| hypothetical protein CICLE_v10018430mg [Citr... 57 2e-06 ref|XP_006445335.1| hypothetical protein CICLE_v10018430mg [Citr... 57 2e-06 ref|XP_006445334.1| hypothetical protein CICLE_v10018430mg [Citr... 57 2e-06 ref|XP_006445333.1| hypothetical protein CICLE_v10018430mg [Citr... 57 2e-06 gb|EMJ21768.1| hypothetical protein PRUPE_ppa000030mg [Prunus pe... 57 3e-06 ref|XP_003633901.1| PREDICTED: CCR4-NOT transcription complex su... 55 1e-05 emb|CAN64906.1| hypothetical protein VITISV_042832 [Vitis vinifera] 55 1e-05 >ref|XP_004306964.1| PREDICTED: CCR4-NOT transcription complex subunit 1-like [Fragaria vesca subsp. vesca] Length = 2328 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = +2 Query: 122 AGQIRFLLQSVNEFNFDSTLRELFQLVECGSEGSTFLLQTCLE 250 A QIRFLLQS+N+ N DS LREL Q +E G EGS LLQTCL+ Sbjct: 9 ANQIRFLLQSLNDANSDSVLRELTQFIEYGIEGSILLLQTCLD 51 >ref|XP_006445336.1| hypothetical protein CICLE_v10018430mg [Citrus clementina] gi|557547598|gb|ESR58576.1| hypothetical protein CICLE_v10018430mg [Citrus clementina] Length = 2362 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +2 Query: 128 QIRFLLQSVNEFNFDSTLRELFQLVECGSEGSTFLLQTCLE 250 QIRFLLQS+NE N DS REL Q +E G EGST +LQTC++ Sbjct: 11 QIRFLLQSLNEANADSVFRELCQFIEYGIEGSTMMLQTCMD 51 >ref|XP_006445335.1| hypothetical protein CICLE_v10018430mg [Citrus clementina] gi|568875529|ref|XP_006490845.1| PREDICTED: CCR4-NOT transcription complex subunit 1-like isoform X1 [Citrus sinensis] gi|557547597|gb|ESR58575.1| hypothetical protein CICLE_v10018430mg [Citrus clementina] Length = 2425 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +2 Query: 128 QIRFLLQSVNEFNFDSTLRELFQLVECGSEGSTFLLQTCLE 250 QIRFLLQS+NE N DS REL Q +E G EGST +LQTC++ Sbjct: 11 QIRFLLQSLNEANADSVFRELCQFIEYGIEGSTMMLQTCMD 51 >ref|XP_006445334.1| hypothetical protein CICLE_v10018430mg [Citrus clementina] gi|557547596|gb|ESR58574.1| hypothetical protein CICLE_v10018430mg [Citrus clementina] Length = 2423 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +2 Query: 128 QIRFLLQSVNEFNFDSTLRELFQLVECGSEGSTFLLQTCLE 250 QIRFLLQS+NE N DS REL Q +E G EGST +LQTC++ Sbjct: 11 QIRFLLQSLNEANADSVFRELCQFIEYGIEGSTMMLQTCMD 51 >ref|XP_006445333.1| hypothetical protein CICLE_v10018430mg [Citrus clementina] gi|568875531|ref|XP_006490846.1| PREDICTED: CCR4-NOT transcription complex subunit 1-like isoform X2 [Citrus sinensis] gi|557547595|gb|ESR58573.1| hypothetical protein CICLE_v10018430mg [Citrus clementina] Length = 2421 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +2 Query: 128 QIRFLLQSVNEFNFDSTLRELFQLVECGSEGSTFLLQTCLE 250 QIRFLLQS+NE N DS REL Q +E G EGST +LQTC++ Sbjct: 11 QIRFLLQSLNEANADSVFRELCQFIEYGIEGSTMMLQTCMD 51 >gb|EMJ21768.1| hypothetical protein PRUPE_ppa000030mg [Prunus persica] Length = 2332 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/42 (69%), Positives = 31/42 (73%) Frame = +2 Query: 122 AGQIRFLLQSVNEFNFDSTLRELFQLVECGSEGSTFLLQTCL 247 A QIRFLLQS+N+ N DS LREL Q E G EGS LLQTCL Sbjct: 9 ASQIRFLLQSLNDANSDSVLRELSQFTEYGIEGSILLLQTCL 50 >ref|XP_003633901.1| PREDICTED: CCR4-NOT transcription complex subunit 1-like [Vitis vinifera] Length = 2333 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/48 (58%), Positives = 33/48 (68%) Frame = +2 Query: 107 SSFIFAGQIRFLLQSVNEFNFDSTLRELFQLVECGSEGSTFLLQTCLE 250 SS FA QIRFLLQS+NE N D EL + V+ G EGS LL+TCL+ Sbjct: 4 SSAAFANQIRFLLQSLNEENADHVFEELREFVDYGIEGSVLLLETCLD 51 >emb|CAN64906.1| hypothetical protein VITISV_042832 [Vitis vinifera] Length = 584 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/48 (58%), Positives = 33/48 (68%) Frame = +2 Query: 107 SSFIFAGQIRFLLQSVNEFNFDSTLRELFQLVECGSEGSTFLLQTCLE 250 SS FA QIRFLLQS+NE N D EL + V+ G EGS LL+TCL+ Sbjct: 4 SSAAFANQIRFLLQSLNEENADHVFEELREFVDYGIEGSVLLLETCLD 51