BLASTX nr result
ID: Zingiber23_contig00045659
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00045659 (272 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB91216.1| Outer envelope protein 80 [Morus notabilis] 57 3e-06 >gb|EXB91216.1| Outer envelope protein 80 [Morus notabilis] Length = 361 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +2 Query: 158 MGAQKSIQAGKAKIDFNVDLTQKLCGAILLPHIRYS 265 MGAQKSI AGKAKID NVD T KLC ++++PH+R S Sbjct: 1 MGAQKSIHAGKAKIDVNVDFTHKLCASLMVPHLRSS 36