BLASTX nr result
ID: Zingiber23_contig00045502
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00045502 (253 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006480598.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-... 55 7e-06 ref|XP_006428880.1| hypothetical protein CICLE_v10010897mg [Citr... 55 7e-06 ref|XP_006428879.1| hypothetical protein CICLE_v10010897mg [Citr... 55 7e-06 >ref|XP_006480598.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like isoform X1 [Citrus sinensis] gi|568853949|ref|XP_006480599.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like isoform X2 [Citrus sinensis] Length = 1523 Score = 55.5 bits (132), Expect = 7e-06 Identities = 32/68 (47%), Positives = 44/68 (64%), Gaps = 1/68 (1%) Frame = +2 Query: 50 VLALAADGSEESAQLATLTELCEVLS-AMEYATQGYRLKALVQPLVNLASKDGNPKILLQ 226 +LA ++ ++ S Q+ +LTELCEVLS AME + +L LV LA + NP I+L Sbjct: 109 ILACLSEDTDPSRQITSLTELCEVLSFAMEDSLSSMMADSLSPVLVKLARHETNPDIMLL 168 Query: 227 AVRALTYL 250 AVRA+TYL Sbjct: 169 AVRAITYL 176 >ref|XP_006428880.1| hypothetical protein CICLE_v10010897mg [Citrus clementina] gi|567872583|ref|XP_006428881.1| hypothetical protein CICLE_v10010897mg [Citrus clementina] gi|557530937|gb|ESR42120.1| hypothetical protein CICLE_v10010897mg [Citrus clementina] gi|557530938|gb|ESR42121.1| hypothetical protein CICLE_v10010897mg [Citrus clementina] Length = 1523 Score = 55.5 bits (132), Expect = 7e-06 Identities = 32/68 (47%), Positives = 44/68 (64%), Gaps = 1/68 (1%) Frame = +2 Query: 50 VLALAADGSEESAQLATLTELCEVLS-AMEYATQGYRLKALVQPLVNLASKDGNPKILLQ 226 +LA ++ ++ S Q+ +LTELCEVLS AME + +L LV LA + NP I+L Sbjct: 109 ILACLSEDTDPSRQITSLTELCEVLSFAMEDSLSSMMADSLSPVLVKLARHETNPDIMLL 168 Query: 227 AVRALTYL 250 AVRA+TYL Sbjct: 169 AVRAITYL 176 >ref|XP_006428879.1| hypothetical protein CICLE_v10010897mg [Citrus clementina] gi|557530936|gb|ESR42119.1| hypothetical protein CICLE_v10010897mg [Citrus clementina] Length = 1463 Score = 55.5 bits (132), Expect = 7e-06 Identities = 32/68 (47%), Positives = 44/68 (64%), Gaps = 1/68 (1%) Frame = +2 Query: 50 VLALAADGSEESAQLATLTELCEVLS-AMEYATQGYRLKALVQPLVNLASKDGNPKILLQ 226 +LA ++ ++ S Q+ +LTELCEVLS AME + +L LV LA + NP I+L Sbjct: 109 ILACLSEDTDPSRQITSLTELCEVLSFAMEDSLSSMMADSLSPVLVKLARHETNPDIMLL 168 Query: 227 AVRALTYL 250 AVRA+TYL Sbjct: 169 AVRAITYL 176