BLASTX nr result
ID: Zingiber23_contig00044467
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00044467 (290 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADX41474.1| NBS-LRR disease resistance protein-like protein [... 56 6e-06 >gb|ADX41474.1| NBS-LRR disease resistance protein-like protein [Setaria italica] Length = 185 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/48 (56%), Positives = 34/48 (70%) Frame = -3 Query: 204 KTTLANKIYRSTDVKNYFQRKAWVFVSQKYEVKELLRSIVKQVFDFKD 61 KTTLA KI S +K YF AWV VSQK+EV +LL+ I+KQ+F +D Sbjct: 7 KTTLARKICTSDKIKQYFDAIAWVTVSQKFEVVDLLKDIMKQIFGGRD 54