BLASTX nr result
ID: Zingiber23_contig00044030
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00044030 (184 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279210.1| PREDICTED: CBS domain-containing protein CBS... 63 5e-08 ref|XP_004971074.1| PREDICTED: CBS domain-containing protein CBS... 62 1e-07 gb|EMJ08669.1| hypothetical protein PRUPE_ppa006223mg [Prunus pe... 62 1e-07 ref|XP_002325465.1| CBS domain-containing family protein [Populu... 62 1e-07 ref|XP_006350399.1| PREDICTED: CBS domain-containing protein CBS... 61 2e-07 ref|XP_004237371.1| PREDICTED: CBS domain-containing protein CBS... 61 2e-07 ref|XP_006480403.1| PREDICTED: CBS domain-containing protein CBS... 60 2e-07 ref|XP_002458994.1| hypothetical protein SORBIDRAFT_03g043980 [S... 60 2e-07 ref|XP_004302150.1| PREDICTED: CBS domain-containing protein CBS... 60 4e-07 gb|AEI83220.1| CBS domain-containing protein [Dimocarpus longan] 60 4e-07 ref|XP_002512622.1| conserved hypothetical protein [Ricinus comm... 60 4e-07 gb|ACL54738.1| unknown [Zea mays] gi|414878989|tpg|DAA56120.1| T... 60 4e-07 gb|ACG29299.1| CBS domain containing protein [Zea mays] 60 4e-07 ref|NP_001130724.1| CBS domain containing protein [Zea mays] gi|... 60 4e-07 dbj|BAK02311.1| predicted protein [Hordeum vulgare subsp. vulgare] 59 5e-07 gb|EAY77001.1| hypothetical protein OsI_04957 [Oryza sativa Indi... 59 5e-07 gb|EXC29924.1| CBS domain-containing protein CBSX6 [Morus notabi... 59 9e-07 ref|XP_002329005.1| predicted protein [Populus trichocarpa] gi|5... 59 9e-07 ref|XP_004152831.1| PREDICTED: CBS domain-containing protein CBS... 58 1e-06 ref|XP_003567407.1| PREDICTED: CBS domain-containing protein CBS... 58 1e-06 >ref|XP_002279210.1| PREDICTED: CBS domain-containing protein CBSX6 [Vitis vinifera] gi|297735292|emb|CBI17654.3| unnamed protein product [Vitis vinifera] Length = 427 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/51 (60%), Positives = 40/51 (78%), Gaps = 2/51 (3%) Frame = -1 Query: 148 RFLGMINSLEVAAFLARTGG--DHDRAMRTPVSEVVTPNPSLLKEVDPRVR 2 RF+G++NSL++ AFLAR D ++AM+TPVSEVV PN SLL+EVDP R Sbjct: 65 RFVGILNSLDIVAFLARDACLVDQEKAMKTPVSEVVVPNNSLLREVDPATR 115 >ref|XP_004971074.1| PREDICTED: CBS domain-containing protein CBSX6-like [Setaria italica] Length = 408 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/53 (58%), Positives = 39/53 (73%) Frame = -1 Query: 160 PCSDRFLGMINSLEVAAFLARTGGDHDRAMRTPVSEVVTPNPSLLKEVDPRVR 2 P RF+GMI++L++AAF+A T G DRAMR V EVV PNP LL+E+DP R Sbjct: 57 PSGVRFIGMISALDIAAFVA-TAGVGDRAMRAVVGEVVQPNPGLLREIDPGTR 108 >gb|EMJ08669.1| hypothetical protein PRUPE_ppa006223mg [Prunus persica] Length = 421 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/51 (54%), Positives = 41/51 (80%), Gaps = 2/51 (3%) Frame = -1 Query: 148 RFLGMINSLEVAAFLARTG--GDHDRAMRTPVSEVVTPNPSLLKEVDPRVR 2 RF+G++NSL++ AF A++ DHD+A++TPVS+VV PN SLL++VDP R Sbjct: 65 RFVGILNSLDIVAFFAKSECLEDHDKALKTPVSDVVVPNNSLLRQVDPATR 115 >ref|XP_002325465.1| CBS domain-containing family protein [Populus trichocarpa] gi|222862340|gb|EEE99846.1| CBS domain-containing family protein [Populus trichocarpa] Length = 422 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/51 (58%), Positives = 40/51 (78%), Gaps = 2/51 (3%) Frame = -1 Query: 148 RFLGMINSLEVAAFLARTG--GDHDRAMRTPVSEVVTPNPSLLKEVDPRVR 2 RF+G++NSL++ AFLA T D D+A++TPVS+VV PN SLLK+VDP R Sbjct: 65 RFVGILNSLDIVAFLASTECLEDRDKAIKTPVSQVVVPNTSLLKQVDPATR 115 >ref|XP_006350399.1| PREDICTED: CBS domain-containing protein CBSX6-like [Solanum tuberosum] Length = 422 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/51 (58%), Positives = 40/51 (78%), Gaps = 2/51 (3%) Frame = -1 Query: 148 RFLGMINSLEVAAFLARTG--GDHDRAMRTPVSEVVTPNPSLLKEVDPRVR 2 RF+G++NSL++ AFLAR D ++AM+TPVSEVV P+ SLLKE+DP R Sbjct: 65 RFVGILNSLDIVAFLAREECLADQEKAMKTPVSEVVLPDNSLLKELDPATR 115 >ref|XP_004237371.1| PREDICTED: CBS domain-containing protein CBSX6-like [Solanum lycopersicum] Length = 420 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/51 (58%), Positives = 40/51 (78%), Gaps = 2/51 (3%) Frame = -1 Query: 148 RFLGMINSLEVAAFLARTG--GDHDRAMRTPVSEVVTPNPSLLKEVDPRVR 2 RF+G++NSL++ AFLAR D ++AM+TPVSEVV P+ SLLKE+DP R Sbjct: 65 RFVGILNSLDIVAFLAREECLADQEKAMKTPVSEVVLPDNSLLKELDPATR 115 >ref|XP_006480403.1| PREDICTED: CBS domain-containing protein CBSX6-like [Citrus sinensis] Length = 433 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/51 (54%), Positives = 40/51 (78%), Gaps = 2/51 (3%) Frame = -1 Query: 148 RFLGMINSLEVAAFLARTG--GDHDRAMRTPVSEVVTPNPSLLKEVDPRVR 2 RF+G++NS ++ AFLA++ D D+AM+TPVS+V+ PN SLLK+VDP R Sbjct: 65 RFVGILNSFDIVAFLAKSDCLEDQDKAMKTPVSQVIVPNNSLLKQVDPGTR 115 >ref|XP_002458994.1| hypothetical protein SORBIDRAFT_03g043980 [Sorghum bicolor] gi|241930969|gb|EES04114.1| hypothetical protein SORBIDRAFT_03g043980 [Sorghum bicolor] Length = 380 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/53 (56%), Positives = 39/53 (73%) Frame = -1 Query: 160 PCSDRFLGMINSLEVAAFLARTGGDHDRAMRTPVSEVVTPNPSLLKEVDPRVR 2 P RF+GMI++L++AAF+A G DRAMR V EVV PNP+LL+E+DP R Sbjct: 57 PSGARFIGMISALDIAAFVAAAGVG-DRAMRAVVGEVVQPNPALLREIDPGTR 108 >ref|XP_004302150.1| PREDICTED: CBS domain-containing protein CBSX6-like [Fragaria vesca subsp. vesca] Length = 426 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/51 (54%), Positives = 39/51 (76%), Gaps = 2/51 (3%) Frame = -1 Query: 148 RFLGMINSLEVAAFLARTG--GDHDRAMRTPVSEVVTPNPSLLKEVDPRVR 2 RF+G++NSL++ AF A+ DHD+A+ TPV+EVV PN SLL++VDP R Sbjct: 64 RFVGILNSLDIVAFFAKKECMEDHDKALNTPVAEVVAPNNSLLRQVDPGTR 114 >gb|AEI83220.1| CBS domain-containing protein [Dimocarpus longan] Length = 202 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/51 (54%), Positives = 40/51 (78%), Gaps = 2/51 (3%) Frame = -1 Query: 148 RFLGMINSLEVAAFLARTG--GDHDRAMRTPVSEVVTPNPSLLKEVDPRVR 2 RF+G++NS ++ +FLA++ D D+AM+TPVSEVV PN SLL++VDP R Sbjct: 43 RFVGILNSFDIVSFLAKSDCLEDQDKAMKTPVSEVVLPNSSLLRQVDPGTR 93 >ref|XP_002512622.1| conserved hypothetical protein [Ricinus communis] gi|223548583|gb|EEF50074.1| conserved hypothetical protein [Ricinus communis] Length = 432 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/51 (56%), Positives = 40/51 (78%), Gaps = 2/51 (3%) Frame = -1 Query: 148 RFLGMINSLEVAAFLARTG--GDHDRAMRTPVSEVVTPNPSLLKEVDPRVR 2 RF+G++NSL++ AFLA+ D ++AM+TPVSEVV P+ SLLK+VDP R Sbjct: 65 RFVGILNSLDIVAFLAKAQCLEDQEKAMKTPVSEVVVPDNSLLKQVDPATR 115 >gb|ACL54738.1| unknown [Zea mays] gi|414878989|tpg|DAA56120.1| TPA: hypothetical protein ZEAMMB73_423536 [Zea mays] Length = 378 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/53 (54%), Positives = 40/53 (75%) Frame = -1 Query: 160 PCSDRFLGMINSLEVAAFLARTGGDHDRAMRTPVSEVVTPNPSLLKEVDPRVR 2 P RF+GMI++L++AAF+A + G DR+MR V EVV PNP+LL+E+DP R Sbjct: 57 PSGARFIGMISALDIAAFVA-SAGVGDRSMRAVVGEVVQPNPALLREIDPGTR 108 >gb|ACG29299.1| CBS domain containing protein [Zea mays] Length = 407 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/53 (54%), Positives = 40/53 (75%) Frame = -1 Query: 160 PCSDRFLGMINSLEVAAFLARTGGDHDRAMRTPVSEVVTPNPSLLKEVDPRVR 2 P RF+GMI++L++AAF+A + G DR+MR V EVV PNP+LL+E+DP R Sbjct: 57 PSGARFIGMISALDIAAFVA-SAGVGDRSMRAVVGEVVQPNPALLREIDPGTR 108 >ref|NP_001130724.1| CBS domain containing protein [Zea mays] gi|194689952|gb|ACF79060.1| unknown [Zea mays] gi|194691690|gb|ACF79929.1| unknown [Zea mays] gi|223948199|gb|ACN28183.1| unknown [Zea mays] gi|414878990|tpg|DAA56121.1| TPA: CBS domain containing protein [Zea mays] Length = 407 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/53 (54%), Positives = 40/53 (75%) Frame = -1 Query: 160 PCSDRFLGMINSLEVAAFLARTGGDHDRAMRTPVSEVVTPNPSLLKEVDPRVR 2 P RF+GMI++L++AAF+A + G DR+MR V EVV PNP+LL+E+DP R Sbjct: 57 PSGARFIGMISALDIAAFVA-SAGVGDRSMRAVVGEVVQPNPALLREIDPGTR 108 >dbj|BAK02311.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 403 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/53 (58%), Positives = 37/53 (69%) Frame = -1 Query: 160 PCSDRFLGMINSLEVAAFLARTGGDHDRAMRTPVSEVVTPNPSLLKEVDPRVR 2 P RFLGMI+++++AAFLA G DRAMR V EVV PN LL+EVDP R Sbjct: 57 PSGARFLGMISAVDIAAFLAGAGAG-DRAMRAAVGEVVQPNQDLLREVDPGTR 108 >gb|EAY77001.1| hypothetical protein OsI_04957 [Oryza sativa Indica Group] Length = 404 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/53 (58%), Positives = 38/53 (71%) Frame = -1 Query: 160 PCSDRFLGMINSLEVAAFLARTGGDHDRAMRTPVSEVVTPNPSLLKEVDPRVR 2 P RFLGMI++L++AAF+A +G DRAM V EVV PNP LL+EVDP R Sbjct: 57 PSGARFLGMISALDIAAFVAASGVG-DRAMAAVVGEVVQPNPGLLREVDPGTR 108 >gb|EXC29924.1| CBS domain-containing protein CBSX6 [Morus notabilis] Length = 453 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/51 (52%), Positives = 40/51 (78%), Gaps = 2/51 (3%) Frame = -1 Query: 148 RFLGMINSLEVAAFLARTG--GDHDRAMRTPVSEVVTPNPSLLKEVDPRVR 2 RF+G++NSL++ AFLAR + D+A++TP+S+VV PN SLL++VDP R Sbjct: 65 RFVGILNSLDIVAFLARAECLENQDKALKTPISDVVVPNNSLLRQVDPATR 115 >ref|XP_002329005.1| predicted protein [Populus trichocarpa] gi|566200185|ref|XP_002319814.2| CBS domain-containing family protein [Populus trichocarpa] gi|550325290|gb|EEE95737.2| CBS domain-containing family protein [Populus trichocarpa] Length = 424 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/51 (56%), Positives = 39/51 (76%), Gaps = 2/51 (3%) Frame = -1 Query: 148 RFLGMINSLEVAAFLARTG--GDHDRAMRTPVSEVVTPNPSLLKEVDPRVR 2 RF+G++NSL++ AFLA T D D+A++T VS+VV PN SLLK+VDP R Sbjct: 65 RFVGILNSLDIVAFLASTECLEDQDKAIKTSVSQVVVPNASLLKQVDPATR 115 >ref|XP_004152831.1| PREDICTED: CBS domain-containing protein CBSX6-like [Cucumis sativus] gi|449477694|ref|XP_004155096.1| PREDICTED: CBS domain-containing protein CBSX6-like isoform 1 [Cucumis sativus] gi|449477697|ref|XP_004155097.1| PREDICTED: CBS domain-containing protein CBSX6-like isoform 2 [Cucumis sativus] Length = 425 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/51 (54%), Positives = 39/51 (76%), Gaps = 2/51 (3%) Frame = -1 Query: 148 RFLGMINSLEVAAFLARTGG--DHDRAMRTPVSEVVTPNPSLLKEVDPRVR 2 RF+G+++SL++ AFLAR+ D +RAM+ PVSE V PN SLL++VDP R Sbjct: 65 RFVGILSSLDIVAFLARSENLEDQERAMKAPVSEAVVPNYSLLRQVDPATR 115 >ref|XP_003567407.1| PREDICTED: CBS domain-containing protein CBSX6-like [Brachypodium distachyon] Length = 367 Score = 57.8 bits (138), Expect = 1e-06 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 1/54 (1%) Frame = -1 Query: 160 PCSDRFLGMINSLEVAAFLARTGGDHDRAMR-TPVSEVVTPNPSLLKEVDPRVR 2 P RF+GMI+++++AAF+A T D DRAMR V EVV PNP LL+EVDP R Sbjct: 57 PSGARFVGMISAVDIAAFVA-TAADGDRAMREAAVGEVVQPNPELLREVDPGTR 109