BLASTX nr result
ID: Zingiber23_contig00042384
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00042384 (325 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004229860.1| PREDICTED: ATPase GET3-like [Solanum lycoper... 57 3e-06 ref|XP_004957396.1| PREDICTED: ATPase ASNA1 homolog [Setaria ita... 57 3e-06 ref|NP_001063707.1| Os09g0521500 [Oryza sativa Japonica Group] g... 57 3e-06 ref|XP_002462688.1| hypothetical protein SORBIDRAFT_02g030280 [S... 57 3e-06 ref|XP_006339493.1| PREDICTED: ATPase ASNA1 homolog [Solanum tub... 56 4e-06 gb|ACG38675.1| arsenical pump-driving ATPase [Zea mays] 56 4e-06 ref|NP_001131886.1| uncharacterized protein LOC100193266 [Zea ma... 56 4e-06 ref|XP_006660858.1| PREDICTED: ATPase ASNA1 homolog [Oryza brach... 55 7e-06 gb|ABG73455.1| arsencial pump-driving ATPase [Oryza brachyantha] 55 7e-06 >ref|XP_004229860.1| PREDICTED: ATPase GET3-like [Solanum lycopersicum] Length = 360 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/37 (56%), Positives = 34/37 (91%) Frame = +1 Query: 1 EEVCGIQALRKMSQHYVTPYKPSLARGTIKEVQERIS 111 +EVCG++AL++ S H+VTPY+PSLARG+++E+Q R++ Sbjct: 301 QEVCGVEALKEFSHHFVTPYQPSLARGSVEELQNRVA 337 >ref|XP_004957396.1| PREDICTED: ATPase ASNA1 homolog [Setaria italica] Length = 363 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/37 (59%), Positives = 33/37 (89%) Frame = +1 Query: 1 EEVCGIQALRKMSQHYVTPYKPSLARGTIKEVQERIS 111 EEVCG+QAL+ SQH++TPYK ++ RGT++E+++RIS Sbjct: 304 EEVCGVQALQNFSQHFLTPYKSAIKRGTVEELEQRIS 340 >ref|NP_001063707.1| Os09g0521500 [Oryza sativa Japonica Group] gi|52075587|dbj|BAD46697.1| putative hASNA-I [Oryza sativa Japonica Group] gi|113631940|dbj|BAF25621.1| Os09g0521500 [Oryza sativa Japonica Group] gi|215678611|dbj|BAG92266.1| unnamed protein product [Oryza sativa Japonica Group] gi|218202473|gb|EEC84900.1| hypothetical protein OsI_32081 [Oryza sativa Indica Group] gi|222630491|gb|EEE62623.1| hypothetical protein OsJ_17426 [Oryza sativa Japonica Group] Length = 361 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/37 (59%), Positives = 33/37 (89%) Frame = +1 Query: 1 EEVCGIQALRKMSQHYVTPYKPSLARGTIKEVQERIS 111 EEVCG+QAL+ S+H++TPYK +L RGT++EV++R+S Sbjct: 302 EEVCGVQALQNFSRHFLTPYKAALKRGTVEEVEQRVS 338 >ref|XP_002462688.1| hypothetical protein SORBIDRAFT_02g030280 [Sorghum bicolor] gi|241926065|gb|EER99209.1| hypothetical protein SORBIDRAFT_02g030280 [Sorghum bicolor] Length = 363 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/37 (62%), Positives = 33/37 (89%) Frame = +1 Query: 1 EEVCGIQALRKMSQHYVTPYKPSLARGTIKEVQERIS 111 EEVCG+QAL+ SQH++TPYK +L RGTI+E+++RI+ Sbjct: 304 EEVCGVQALQNFSQHFLTPYKSNLKRGTIEELEQRIT 340 >ref|XP_006339493.1| PREDICTED: ATPase ASNA1 homolog [Solanum tuberosum] Length = 360 Score = 56.2 bits (134), Expect = 4e-06 Identities = 21/37 (56%), Positives = 33/37 (89%) Frame = +1 Query: 1 EEVCGIQALRKMSQHYVTPYKPSLARGTIKEVQERIS 111 +EVCG+ AL++ S H+VTPY+PSLARG+++E+Q R++ Sbjct: 301 QEVCGVDALKEFSHHFVTPYQPSLARGSVEELQNRVA 337 >gb|ACG38675.1| arsenical pump-driving ATPase [Zea mays] Length = 363 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/37 (59%), Positives = 33/37 (89%) Frame = +1 Query: 1 EEVCGIQALRKMSQHYVTPYKPSLARGTIKEVQERIS 111 EEVCG+QAL+ SQH++TPYK +L RGT++E+++RI+ Sbjct: 304 EEVCGVQALQNFSQHFLTPYKSTLKRGTVEELEQRIT 340 >ref|NP_001131886.1| uncharacterized protein LOC100193266 [Zea mays] gi|194692820|gb|ACF80494.1| unknown [Zea mays] gi|414590010|tpg|DAA40581.1| TPA: hypothetical protein ZEAMMB73_906102 [Zea mays] Length = 363 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/37 (59%), Positives = 33/37 (89%) Frame = +1 Query: 1 EEVCGIQALRKMSQHYVTPYKPSLARGTIKEVQERIS 111 EEVCG+QAL+ SQH++TPYK +L RGT++E+++RI+ Sbjct: 304 EEVCGVQALQNFSQHFLTPYKSTLKRGTVEELEQRIT 340 >ref|XP_006660858.1| PREDICTED: ATPase ASNA1 homolog [Oryza brachyantha] Length = 360 Score = 55.5 bits (132), Expect = 7e-06 Identities = 21/37 (56%), Positives = 33/37 (89%) Frame = +1 Query: 1 EEVCGIQALRKMSQHYVTPYKPSLARGTIKEVQERIS 111 EEVCG+QAL+ S+H++TPYK +L RGT++E+++R+S Sbjct: 301 EEVCGVQALQNFSRHFLTPYKSALKRGTVEELEQRVS 337 >gb|ABG73455.1| arsencial pump-driving ATPase [Oryza brachyantha] Length = 364 Score = 55.5 bits (132), Expect = 7e-06 Identities = 21/37 (56%), Positives = 33/37 (89%) Frame = +1 Query: 1 EEVCGIQALRKMSQHYVTPYKPSLARGTIKEVQERIS 111 EEVCG+QAL+ S+H++TPYK +L RGT++E+++R+S Sbjct: 301 EEVCGVQALQNFSRHFLTPYKSALKRGTVEELEQRVS 337