BLASTX nr result
ID: Zingiber23_contig00041882
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00041882 (307 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002448804.1| hypothetical protein SORBIDRAFT_06g033580 [S... 55 1e-05 >ref|XP_002448804.1| hypothetical protein SORBIDRAFT_06g033580 [Sorghum bicolor] gi|241939987|gb|EES13132.1| hypothetical protein SORBIDRAFT_06g033580 [Sorghum bicolor] Length = 219 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/52 (57%), Positives = 32/52 (61%), Gaps = 11/52 (21%) Frame = +3 Query: 3 KVGTWISGWYHLHVNCPALLV--RKPGSYD---------FRFQQSTRCSVDV 125 KVGTWISG YHL VNCPALL GSY FRFQQ+ C+VDV Sbjct: 168 KVGTWISGHYHLRVNCPALLTVNEGKGSYGANTGGGTGYFRFQQAAACAVDV 219