BLASTX nr result
ID: Zingiber23_contig00041162
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00041162 (222 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007475705.1| hypothetical chloroplast RF34 [Zingiber spec... 94 2e-17 gb|AEZ48790.1| photosystem I assembly protein Ycf3, partial [Spa... 94 2e-17 ref|YP_008854595.1| hypothetical chloroplast RF34 [Curcuma rosco... 94 2e-17 ref|YP_874654.1| photosystem I assembly protein ycf3 [Hordeum vu... 93 3e-17 gb|AHI87528.1| photosystem I assembly protein Ycf3, hypothetical... 93 4e-17 ref|YP_052750.1| photosystem I assembly protein Ycf3 [Oryza niva... 93 4e-17 ref|NP_039384.1| photosystem I assembly protein Ycf3 [Oryza sati... 93 4e-17 prf||1603356AC intron-containing ORF 170 93 4e-17 sp|P0C517.1|YCF3_ORYSI RecName: Full=Photosystem I assembly prot... 93 4e-17 dbj|BAD81968.1| Chloroplast photosystem I assembly protein Ycf3 ... 93 4e-17 ref|YP_008854426.1| hypothetical chloroplast RF34 [Musa textilis... 92 5e-17 ref|YP_007475962.1| hypothetical chloroplast RF34 [Bismarckia no... 92 5e-17 ref|YP_007475620.1| hypothetical chloroplast RF34 [Heliconia col... 92 5e-17 gb|AEZ48794.1| photosystem I assembly protein Ycf3, partial [Tra... 92 5e-17 gb|ADD30856.1| putative RF3 protein [Dillenia indica] 92 5e-17 ref|YP_538936.1| photosystem I assembly protein Ycf3 [Gossypium ... 92 9e-17 ref|YP_006503444.1| photosystem I assembly protein Ycf3 (chlorop... 92 9e-17 ref|YP_784474.1| photosystem I assembly protein ycf3 [Piper ceno... 92 9e-17 sp|P27324.2|YCF3_MAIZE RecName: Full=Photosystem I assembly prot... 91 1e-16 gb|AAB30283.2| IRF170 [Zea mays subsp. mays] 91 1e-16 >ref|YP_007475705.1| hypothetical chloroplast RF34 [Zingiber spectabile] gi|449326185|gb|AGE92770.1| hypothetical chloroplast RF34 [Zingiber spectabile] Length = 169 Score = 94.0 bits (232), Expect = 2e-17 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = +2 Query: 77 MPRSQINANFIDKTFSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE 220 MPRSQINANFIDKT SIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE Sbjct: 1 MPRSQINANFIDKTSSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE 48 >gb|AEZ48790.1| photosystem I assembly protein Ycf3, partial [Sparganium eurycarpum] Length = 168 Score = 94.0 bits (232), Expect = 2e-17 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = +2 Query: 77 MPRSQINANFIDKTFSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE 220 MPRS+IN NFIDKTFSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE 48 >ref|YP_008854595.1| hypothetical chloroplast RF34 [Curcuma roscoeana] gi|374411597|gb|AEZ48789.1| photosystem I assembly protein Ycf3, partial [Renealmia alpinia] gi|449326793|gb|AGE93371.1| hypothetical chloroplast RF34 [Alpinia zerumbet] gi|557637502|gb|AHA13097.1| hypothetical chloroplast RF34 [Curcuma roscoeana] Length = 168 Score = 94.0 bits (232), Expect = 2e-17 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = +2 Query: 77 MPRSQINANFIDKTFSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE 220 MPRSQINANFIDKT SIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE Sbjct: 1 MPRSQINANFIDKTSSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE 48 >ref|YP_874654.1| photosystem I assembly protein ycf3 [Hordeum vulgare subsp. vulgare] gi|171704520|sp|A1E9J2.1|YCF3_HORVU RecName: Full=Photosystem I assembly protein Ycf3 gi|118201043|gb|ABK79414.1| photosystem I assembly protein ycf3 [Hordeum vulgare subsp. vulgare] Length = 170 Score = 93.2 bits (230), Expect = 3e-17 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = +2 Query: 77 MPRSQINANFIDKTFSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE 220 MPRS++N NFIDKTFSI+ANILLRIIPTTSGEKKAFTYYRDGMLAQSE Sbjct: 1 MPRSRVNGNFIDKTFSIIANILLRIIPTTSGEKKAFTYYRDGMLAQSE 48 >gb|AHI87528.1| photosystem I assembly protein Ycf3, hypothetical chloroplast RF34 (chloroplast) [Chionographis japonica] Length = 170 Score = 92.8 bits (229), Expect = 4e-17 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = +2 Query: 77 MPRSQINANFIDKTFSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE 220 MPRS+IN NFIDKTFSIVANI+LRIIPTTSGEKKAFTYYRDGMLAQSE Sbjct: 1 MPRSRINGNFIDKTFSIVANIVLRIIPTTSGEKKAFTYYRDGMLAQSE 48 >ref|YP_052750.1| photosystem I assembly protein Ycf3 [Oryza nivara] gi|68053141|sp|Q6ENH3.1|YCF3_ORYNI RecName: Full=Photosystem I assembly protein Ycf3 gi|49614996|dbj|BAD26779.1| photosystem I assembly protein Ycf3 [Oryza nivara] Length = 170 Score = 92.8 bits (229), Expect = 4e-17 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = +2 Query: 77 MPRSQINANFIDKTFSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE 220 MPRS+IN NFIDKTFSIVANILLRIIPTTSGEK+AFTYYRDGMLAQSE Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKRAFTYYRDGMLAQSE 48 >ref|NP_039384.1| photosystem I assembly protein Ycf3 [Oryza sativa Japonica Group] gi|669081|emb|CAA33997.1| unnamed protein product [Oryza sativa Japonica Group] Length = 169 Score = 92.8 bits (229), Expect = 4e-17 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = +2 Query: 77 MPRSQINANFIDKTFSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE 220 MPRS+IN NFIDKTFSIVANILLRIIPTTSGEK+AFTYYRDGMLAQSE Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKRAFTYYRDGMLAQSE 48 >prf||1603356AC intron-containing ORF 170 Length = 170 Score = 92.8 bits (229), Expect = 4e-17 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = +2 Query: 77 MPRSQINANFIDKTFSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE 220 MPRS+IN NFIDKTFSIVANILLRIIPTTSGEK+AFTYYRDGMLAQSE Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKRAFTYYRDGMLAQSE 48 >sp|P0C517.1|YCF3_ORYSI RecName: Full=Photosystem I assembly protein Ycf3 gi|148887458|sp|P12203.3|YCF3_ORYSJ RecName: Full=Photosystem I assembly protein Ycf3 gi|148897905|sp|P0C516.1|YCF3_ORYSA RecName: Full=Photosystem I assembly protein Ycf3 Length = 170 Score = 92.8 bits (229), Expect = 4e-17 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = +2 Query: 77 MPRSQINANFIDKTFSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE 220 MPRS+IN NFIDKTFSIVANILLRIIPTTSGEK+AFTYYRDGMLAQSE Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKRAFTYYRDGMLAQSE 48 >dbj|BAD81968.1| Chloroplast photosystem I assembly protein Ycf3 [Oryza sativa Japonica Group] Length = 169 Score = 92.8 bits (229), Expect = 4e-17 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = +2 Query: 77 MPRSQINANFIDKTFSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE 220 MPRS+IN NFIDKTFSIVANILLRIIPTTSGEK+AFTYYRDGMLAQSE Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKRAFTYYRDGMLAQSE 48 >ref|YP_008854426.1| hypothetical chloroplast RF34 [Musa textilis] gi|525312458|emb|CCW72376.1| ycf3 (chloroplast) [Musa acuminata subsp. malaccensis] gi|557636913|gb|AHA12515.1| hypothetical chloroplast RF34 [Musa textilis] Length = 168 Score = 92.4 bits (228), Expect = 5e-17 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = +2 Query: 77 MPRSQINANFIDKTFSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE 220 MPRS+INANFIDKT SIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE Sbjct: 1 MPRSRINANFIDKTSSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE 48 >ref|YP_007475962.1| hypothetical chloroplast RF34 [Bismarckia nobilis] gi|449326445|gb|AGE93027.1| hypothetical chloroplast RF34 [Bismarckia nobilis] Length = 170 Score = 92.4 bits (228), Expect = 5e-17 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = +2 Query: 77 MPRSQINANFIDKTFSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE 220 MPRS+INANFIDKT SIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE Sbjct: 1 MPRSRINANFIDKTSSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE 48 >ref|YP_007475620.1| hypothetical chloroplast RF34 [Heliconia collinsiana] gi|449326099|gb|AGE92685.1| hypothetical chloroplast RF34 [Heliconia collinsiana] gi|557637157|gb|AHA12756.1| hypothetical chloroplast RF34 [Canna indica] gi|557637589|gb|AHA13183.1| hypothetical chloroplast RF34 [Thaumatococcus daniellii] Length = 168 Score = 92.4 bits (228), Expect = 5e-17 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = +2 Query: 77 MPRSQINANFIDKTFSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE 220 MPRS+INANFIDKT SIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE Sbjct: 1 MPRSRINANFIDKTSSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE 48 >gb|AEZ48794.1| photosystem I assembly protein Ycf3, partial [Tradescantia ohiensis] Length = 168 Score = 92.4 bits (228), Expect = 5e-17 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = +2 Query: 77 MPRSQINANFIDKTFSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE 220 MPRS+INANFIDKT SIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE Sbjct: 1 MPRSRINANFIDKTSSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE 48 >gb|ADD30856.1| putative RF3 protein [Dillenia indica] Length = 168 Score = 92.4 bits (228), Expect = 5e-17 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = +2 Query: 77 MPRSQINANFIDKTFSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE 220 MPRS+IN NFIDKTFSIVANILLRIIPTTSGEK+AFTYYRDGMLAQSE Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGMLAQSE 48 >ref|YP_538936.1| photosystem I assembly protein Ycf3 [Gossypium hirsutum] gi|119368500|ref|YP_913188.1| PSI accumulation protein [Gossypium barbadense] gi|325210931|ref|YP_004286005.1| hypothetical chloroplast RF34 [Gossypium thurberi] gi|372290933|ref|YP_005087694.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium raimondii] gi|372291032|ref|YP_005087790.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium darwinii] gi|372291386|ref|YP_005088281.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium tomentosum] gi|372291484|ref|YP_005088377.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium herbaceum subsp. africanum] gi|372291774|ref|YP_005088917.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium mustelinum] gi|372291858|ref|YP_005089000.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium arboreum] gi|386800838|ref|YP_006303492.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium gossypioides] gi|394830627|ref|YP_006503278.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium incanum] gi|394830714|ref|YP_006503361.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium somalense] gi|394830889|ref|YP_006503527.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium areysianum] gi|394830976|ref|YP_006503610.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium robinsonii] gi|570758969|ref|YP_008992551.1| hypothetical chloroplast RF34 (chloroplast) [Gossypium bickii] gi|570759057|ref|YP_008992896.1| hypothetical chloroplast RF34 (chloroplast) [Gossypium sturtianum] gi|570759577|ref|YP_008992638.1| hypothetical chloroplast RF34 (chloroplast) [Gossypium herbaceum] gi|570759663|ref|YP_008992724.1| hypothetical chloroplast RF34 (chloroplast) [Gossypium longicalyx] gi|570879914|ref|YP_008992810.1| hypothetical chloroplast RF34 (chloroplast) [Gossypium stocksii] gi|122226162|sp|Q2L906.1|YCF3_GOSHI RecName: Full=Photosystem I assembly protein Ycf3 gi|125991253|sp|A0ZZ36.1|YCF3_GOSBA RecName: Full=Photosystem I assembly protein Ycf3 gi|85687417|gb|ABC73629.1| photosystem I assembly protein ycf3 [Gossypium hirsutum] gi|119224862|dbj|BAF41248.1| PSI accumulation protein [Gossypium barbadense] gi|290775793|gb|ADD62289.1| hypothetical chloroplast RF34 [Gossypium thurberi] gi|318084317|gb|ADV38793.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium arboreum] gi|318084400|gb|ADV38875.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium darwinii] gi|318084485|gb|ADV38959.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium herbaceum subsp. africanum] gi|318084569|gb|ADV39042.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium mustelinum] gi|318084651|gb|ADV39123.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium raimondii] gi|318084737|gb|ADV39208.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium tomentosum] gi|326457128|gb|ADZ74391.1| hypothetical chloroplast RF34 [Gossypium bickii] gi|326457216|gb|ADZ74478.1| hypothetical chloroplast RF34 [Gossypium herbaceum] gi|326457302|gb|ADZ74563.1| hypothetical chloroplast RF34 [Gossypium longicalyx] gi|326457389|gb|ADZ74649.1| hypothetical chloroplast RF34 [Gossypium stocksii] gi|326457477|gb|ADZ74736.1| hypothetical chloroplast RF34 [Gossypium sturtianum] gi|329317072|gb|AEB90431.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium gossypioides] gi|329317156|gb|AEB90514.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium hirsutum] gi|329317240|gb|AEB90597.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium hirsutum] gi|329317324|gb|AEB90680.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium barbadense] gi|329317408|gb|AEB90763.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium barbadense] gi|329317492|gb|AEB90846.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium barbadense] gi|335354332|gb|AEH42952.1| photosystem I assembly protein Ycf3 [Gossypium incanum] gi|335354416|gb|AEH43035.1| photosystem I assembly protein Ycf3 [Gossypium somalense] gi|335354584|gb|AEH43201.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium areysianum] gi|335354668|gb|AEH43284.1| photosystem I assembly protein Ycf3 [Gossypium robinsonii] Length = 168 Score = 91.7 bits (226), Expect = 9e-17 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = +2 Query: 77 MPRSQINANFIDKTFSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE 220 MPRSQIN NFIDKTFSIVANILLRIIPTTSGEK+AFTYYRDGM AQSE Sbjct: 1 MPRSQINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGMSAQSE 48 >ref|YP_006503444.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium capitis-viridis] gi|570758881|ref|YP_008992465.1| hypothetical chloroplast RF34 (chloroplast) [Gossypium anomalum] gi|326457040|gb|ADZ74304.1| hypothetical chloroplast RF34 [Gossypium anomalum] gi|335354500|gb|AEH43118.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium capitis-viridis] Length = 168 Score = 91.7 bits (226), Expect = 9e-17 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = +2 Query: 77 MPRSQINANFIDKTFSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE 220 MPRSQIN NFIDKTFSIVANILLRIIPTTSGEK+AFTYYRDGM AQSE Sbjct: 1 MPRSQINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGMSAQSE 48 >ref|YP_784474.1| photosystem I assembly protein ycf3 [Piper cenocladum] gi|122164361|sp|Q06GQ9.1|YCF3_PIPCE RecName: Full=Photosystem I assembly protein Ycf3 gi|112253752|gb|ABI14473.1| photosystem I assembly protein ycf3 [Piper cenocladum] Length = 168 Score = 91.7 bits (226), Expect = 9e-17 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = +2 Query: 77 MPRSQINANFIDKTFSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE 220 MPRSQIN NFIDKTFSIVANILLRIIPTTSGEK+AFTYYRDGM AQSE Sbjct: 1 MPRSQINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGMSAQSE 48 >sp|P27324.2|YCF3_MAIZE RecName: Full=Photosystem I assembly protein Ycf3; AltName: Full=IRF170 gi|93140420|sp|P0C160.1|YCF3_SACHY RecName: Full=Photosystem I assembly protein Ycf3 Length = 170 Score = 91.3 bits (225), Expect = 1e-16 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = +2 Query: 77 MPRSQINANFIDKTFSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE 220 MPRS+IN NFIDKTFSIVANILL+IIPTTSGEK+AFTYYRDGMLAQSE Sbjct: 1 MPRSRINGNFIDKTFSIVANILLQIIPTTSGEKRAFTYYRDGMLAQSE 48 >gb|AAB30283.2| IRF170 [Zea mays subsp. mays] Length = 170 Score = 91.3 bits (225), Expect = 1e-16 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = +2 Query: 77 MPRSQINANFIDKTFSIVANILLRIIPTTSGEKKAFTYYRDGMLAQSE 220 MPRS+IN NFIDKTFSIVANILL+IIPTTSGEK+AFTYYRDGMLAQSE Sbjct: 1 MPRSRINGNFIDKTFSIVANILLQIIPTTSGEKRAFTYYRDGMLAQSE 48