BLASTX nr result
ID: Zingiber23_contig00040852
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00040852 (271 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002303019.1| hypothetical protein POPTR_0002s24000g [Popu... 42 8e-06 >ref|XP_002303019.1| hypothetical protein POPTR_0002s24000g [Populus trichocarpa] gi|222844745|gb|EEE82292.1| hypothetical protein POPTR_0002s24000g [Populus trichocarpa] Length = 181 Score = 42.0 bits (97), Expect(2) = 8e-06 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 2/35 (5%) Frame = +2 Query: 74 LLVSSTAAYDGGDA--YDVLRSHGLPIGLLPKGVQ 172 L++S T Y + YDVL++HGLPIGLLPKGV+ Sbjct: 11 LVISITTVYSDQEKSIYDVLKAHGLPIGLLPKGVK 45 Score = 33.1 bits (74), Expect(2) = 8e-06 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +3 Query: 174 EFPINADGRFQARLPSPCTAKFDGEVLYNATV 269 EF I+ GRF+ L C AKF+ E+ Y+ V Sbjct: 46 EFKIDETGRFEVHLDQACNAKFESELHYDMNV 77