BLASTX nr result
ID: Zingiber23_contig00039155
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00039155 (331 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD33026.2| Cyclin-like F-box; FAR1; Zinc finger, SWIM-type [... 55 3e-07 >gb|ABD33026.2| Cyclin-like F-box; FAR1; Zinc finger, SWIM-type [Medicago truncatula] Length = 1116 Score = 55.5 bits (132), Expect(2) = 3e-07 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +3 Query: 195 IGMTFSSEEEVCTFYNSYAQNVGFGIYKLGGRNRDEGK*KYFSIG 329 IGMTFSSEEEV +Y SYA+ +GFG K+ +N +GK KYF++G Sbjct: 354 IGMTFSSEEEVIKYYKSYARCMGFGTVKINSKNAKDGK-KYFTLG 397 Score = 24.6 bits (52), Expect(2) = 3e-07 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +2 Query: 77 GEESVIEEEKSHSNEIKDNNDHAN 148 G S ++EE H NE D N AN Sbjct: 321 GSTSSVQEEVDHINENSDENLEAN 344