BLASTX nr result
ID: Zingiber23_contig00039141
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00039141 (240 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006443899.1| hypothetical protein CICLE_v10020867mg [Citr... 62 1e-07 ref|XP_002520995.1| WRKY transcription factor, putative [Ricinus... 61 2e-07 gb|ESW16695.1| hypothetical protein PHAVU_007G177900g [Phaseolus... 60 2e-07 gb|EOY11041.1| WRKY DNA-binding protein 21 isoform 2 [Theobroma ... 59 5e-07 gb|EOY11040.1| WRKY DNA-binding protein 21 isoform 1 [Theobroma ... 59 5e-07 ref|XP_002531273.1| WRKY transcription factor, putative [Ricinus... 59 5e-07 ref|XP_006603478.1| PREDICTED: myb-related protein 315-like [Gly... 59 7e-07 gb|EOX94554.1| WRKY DNA-binding protein 21 [Theobroma cacao] 59 9e-07 gb|EXB81319.1| putative WRKY transcription factor 21 [Morus nota... 58 1e-06 ref|XP_002302070.2| WRKY transcription factor 21 family protein ... 58 1e-06 ref|XP_003536883.1| PREDICTED: probable WRKY transcription facto... 58 1e-06 ref|XP_002306823.1| WRKY transcription factor 21 family protein ... 58 1e-06 gb|AGX27509.1| WRKY39-1 [Gossypium hirsutum] 58 1e-06 gb|AGX27508.1| WRKY39-1 [Gossypium hirsutum] 58 1e-06 gb|ADL36862.1| WRKY domain class transcription factor [Malus dom... 57 2e-06 emb|CBI35175.3| unnamed protein product [Vitis vinifera] 57 2e-06 ref|XP_002270614.1| PREDICTED: probable WRKY transcription facto... 57 2e-06 emb|CAN78417.1| hypothetical protein VITISV_001732 [Vitis vinifera] 57 2e-06 ref|XP_006603348.1| PREDICTED: protein WRKY1-like [Glycine max] 57 3e-06 gb|AAL75474.1| DNA binding protein [Elaeis oleifera] 57 3e-06 >ref|XP_006443899.1| hypothetical protein CICLE_v10020867mg [Citrus clementina] gi|568851809|ref|XP_006479579.1| PREDICTED: probable WRKY transcription factor 21-like [Citrus sinensis] gi|557546161|gb|ESR57139.1| hypothetical protein CICLE_v10020867mg [Citrus clementina] Length = 352 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = -3 Query: 142 MEEVEKANIAAVESCRRVLSLLFRPQDQAQSGNLLAETEDAIAGFRK 2 MEEVE+AN AAVESC RVLSLL +PQDQ Q NL+ ET +A+ F+K Sbjct: 1 MEEVEEANKAAVESCHRVLSLLSQPQDQVQYKNLMVETGEAVFRFKK 47 >ref|XP_002520995.1| WRKY transcription factor, putative [Ricinus communis] gi|223539832|gb|EEF41412.1| WRKY transcription factor, putative [Ricinus communis] Length = 353 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = -3 Query: 142 MEEVEKANIAAVESCRRVLSLLFRPQDQAQSGNLLAETEDAIAGFRK 2 MEEVE+AN AVESC RVLSLL +PQDQ Q NL+AET +A+ F++ Sbjct: 1 MEEVEEANRTAVESCHRVLSLLSKPQDQVQYRNLMAETGEAVFKFKR 47 >gb|ESW16695.1| hypothetical protein PHAVU_007G177900g [Phaseolus vulgaris] Length = 358 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/47 (63%), Positives = 36/47 (76%) Frame = -3 Query: 142 MEEVEKANIAAVESCRRVLSLLFRPQDQAQSGNLLAETEDAIAGFRK 2 MEEVE+AN AVESC RVLSLL +P+DQ Q NL+ ET DA+ F+K Sbjct: 1 MEEVEQANRTAVESCHRVLSLLSQPRDQVQHRNLVMETGDAVVRFKK 47 >gb|EOY11041.1| WRKY DNA-binding protein 21 isoform 2 [Theobroma cacao] Length = 312 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = -3 Query: 142 MEEVEKANIAAVESCRRVLSLLFRPQDQAQSGNLLAETEDAIAGFRK 2 MEEVE+AN AA+ESC RVLSLL P+DQ Q NL+ ET +A+ F+K Sbjct: 1 MEEVEQANKAAIESCHRVLSLLSSPKDQVQYSNLMMETGEAVFKFKK 47 >gb|EOY11040.1| WRKY DNA-binding protein 21 isoform 1 [Theobroma cacao] Length = 352 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = -3 Query: 142 MEEVEKANIAAVESCRRVLSLLFRPQDQAQSGNLLAETEDAIAGFRK 2 MEEVE+AN AA+ESC RVLSLL P+DQ Q NL+ ET +A+ F+K Sbjct: 1 MEEVEQANKAAIESCHRVLSLLSSPKDQVQYSNLMMETGEAVFKFKK 47 >ref|XP_002531273.1| WRKY transcription factor, putative [Ricinus communis] gi|223529106|gb|EEF31086.1| WRKY transcription factor, putative [Ricinus communis] Length = 263 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/47 (57%), Positives = 39/47 (82%) Frame = -3 Query: 142 MEEVEKANIAAVESCRRVLSLLFRPQDQAQSGNLLAETEDAIAGFRK 2 MEEVE+AN AAVESCRRV++LL +P+DQ Q+ NL+ ET + ++ F++ Sbjct: 1 MEEVEEANKAAVESCRRVIALLCQPRDQVQARNLVTETGETVSKFKR 47 >ref|XP_006603478.1| PREDICTED: myb-related protein 315-like [Glycine max] Length = 214 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = -3 Query: 142 MEEVEKANIAAVESCRRVLSLLFRPQDQAQSGNLLAETEDAIAGFRK 2 MEEVE+AN AVESC RVLSLL +P+DQ Q NL+ ET + + F+K Sbjct: 145 MEEVEQANRVAVESCHRVLSLLSQPRDQVQRRNLMVETSETVVRFKK 191 >gb|EOX94554.1| WRKY DNA-binding protein 21 [Theobroma cacao] Length = 352 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = -3 Query: 142 MEEVEKANIAAVESCRRVLSLLFRPQDQAQSGNLLAETEDAIAGFRK 2 MEEVE AN AAVESC RVLS+L +PQDQ NL+AET +A+ F++ Sbjct: 1 MEEVEDANKAAVESCHRVLSILSQPQDQVHYRNLMAETGEAVFRFKR 47 >gb|EXB81319.1| putative WRKY transcription factor 21 [Morus notabilis] Length = 352 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = -3 Query: 142 MEEVEKANIAAVESCRRVLSLLFRPQDQAQSGNLLAETEDAIAGFRK 2 MEEVE+AN AAVESC RVLS L +PQDQ Q NL+ ET +A+ F++ Sbjct: 1 MEEVEEANKAAVESCHRVLSSLSQPQDQVQRRNLVVETGEAVFRFKR 47 >ref|XP_002302070.2| WRKY transcription factor 21 family protein [Populus trichocarpa] gi|550344267|gb|EEE81343.2| WRKY transcription factor 21 family protein [Populus trichocarpa] Length = 351 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = -3 Query: 142 MEEVEKANIAAVESCRRVLSLLFRPQDQAQSGNLLAETEDAIAGFRK 2 ME VE+AN AAVESC RV+SLL +PQDQ Q NL+ ET +A+ F+K Sbjct: 1 MEGVEEANRAAVESCHRVISLLSQPQDQVQYRNLMVETGEAVFRFKK 47 >ref|XP_003536883.1| PREDICTED: probable WRKY transcription factor 21-like isoform X1 [Glycine max] Length = 392 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = -3 Query: 142 MEEVEKANIAAVESCRRVLSLLFRPQDQAQSGNLLAETEDAIAGFRK 2 MEEVE+AN AVESC RVLSLL +P+DQ Q NL+ ET + + F+K Sbjct: 37 MEEVEQANRVAVESCHRVLSLLSQPRDQVQHRNLMVETGETVVRFKK 83 >ref|XP_002306823.1| WRKY transcription factor 21 family protein [Populus trichocarpa] gi|222856272|gb|EEE93819.1| WRKY transcription factor 21 family protein [Populus trichocarpa] Length = 347 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = -3 Query: 142 MEEVEKANIAAVESCRRVLSLLFRPQDQAQSGNLLAETEDAIAGFRK 2 ME VE+AN AAVESC RV+SLL +PQDQ Q NL+ ET +A+ F+K Sbjct: 1 MEGVEEANRAAVESCHRVISLLSQPQDQVQYRNLMVETGEAVFRFKK 47 >gb|AGX27509.1| WRKY39-1 [Gossypium hirsutum] Length = 319 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = -3 Query: 142 MEEVEKANIAAVESCRRVLSLLFRPQDQAQSGNLLAETEDAIAGFRK 2 MEEVE+AN AAVESC RVLS L +P+DQ Q NL+AET +A+ F++ Sbjct: 1 MEEVEEANKAAVESCHRVLSSLSQPKDQIQYRNLMAETGEAVFRFKR 47 >gb|AGX27508.1| WRKY39-1 [Gossypium hirsutum] Length = 321 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = -3 Query: 142 MEEVEKANIAAVESCRRVLSLLFRPQDQAQSGNLLAETEDAIAGFRK 2 MEEVE+AN AAVESC RVLS L +P+DQ Q NL+AET +A+ F++ Sbjct: 1 MEEVEEANKAAVESCHRVLSSLSQPKDQIQYRNLMAETGEAVFRFKR 47 >gb|ADL36862.1| WRKY domain class transcription factor [Malus domestica] Length = 355 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = -3 Query: 142 MEEVEKANIAAVESCRRVLSLLFRPQDQAQSGNLLAETEDAIAGFRK 2 MEEVE+AN AVESC RVLSLL +PQ+Q Q NL ET A++ F+K Sbjct: 1 MEEVEEANKTAVESCHRVLSLLSQPQEQVQYRNLTVETGKAVSRFKK 47 >emb|CBI35175.3| unnamed protein product [Vitis vinifera] Length = 304 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = -3 Query: 142 MEEVEKANIAAVESCRRVLSLLFRPQDQAQSGNLLAETEDAIAGFRK 2 ME VE+AN +AVESC RVLS L +PQDQ Q NL+ ETE+A+ F++ Sbjct: 1 MEGVEEANKSAVESCHRVLSFLCQPQDQVQYRNLMMETEEAVFKFKR 47 >ref|XP_002270614.1| PREDICTED: probable WRKY transcription factor 74-like [Vitis vinifera] Length = 362 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = -3 Query: 142 MEEVEKANIAAVESCRRVLSLLFRPQDQAQSGNLLAETEDAIAGFRK 2 ME VE+AN +AVESC RVLS L +PQDQ Q NL+ ETE+A+ F++ Sbjct: 1 MEGVEEANKSAVESCHRVLSFLCQPQDQVQYRNLMMETEEAVFKFKR 47 >emb|CAN78417.1| hypothetical protein VITISV_001732 [Vitis vinifera] Length = 307 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = -3 Query: 142 MEEVEKANIAAVESCRRVLSLLFRPQDQAQSGNLLAETEDAIAGFRK 2 ME VE+AN +AVESC RVLS L +PQDQ Q NL+ ETE+A+ F++ Sbjct: 1 MEGVEEANKSAVESCHRVLSFLCQPQDQVQYRNLMMETEEAVFKFKR 47 >ref|XP_006603348.1| PREDICTED: protein WRKY1-like [Glycine max] Length = 124 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/47 (57%), Positives = 34/47 (72%) Frame = -3 Query: 142 MEEVEKANIAAVESCRRVLSLLFRPQDQAQSGNLLAETEDAIAGFRK 2 MEEVE+AN VESC RVLSLL +P+DQ Q NL+ ET + + F+K Sbjct: 55 MEEVEQANRVVVESCHRVLSLLSQPRDQVQHRNLMVETGETVVRFKK 101 >gb|AAL75474.1| DNA binding protein [Elaeis oleifera] Length = 460 Score = 56.6 bits (135), Expect = 3e-06 Identities = 32/59 (54%), Positives = 41/59 (69%) Frame = -3 Query: 178 GFLGLI*SCDFEMEEVEKANIAAVESCRRVLSLLFRPQDQAQSGNLLAETEDAIAGFRK 2 G LGL ME+VE+AN AAVESC RVLSLL + QDQ Q NL+AE +A++ F++ Sbjct: 12 GVLGL----GVAMEKVEEANRAAVESCHRVLSLLSQSQDQVQYTNLVAEAGEAVSRFKR 66