BLASTX nr result
ID: Zingiber23_contig00038898
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00038898 (525 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago ... 87 2e-15 ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago ... 73 4e-11 tpg|DAA62789.1| TPA: hypothetical protein ZEAMMB73_456670 [Zea m... 59 7e-07 tpg|DAA39238.1| TPA: hypothetical protein ZEAMMB73_219766 [Zea m... 41 9e-06 >ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago truncatula] gi|355516767|gb|AES98390.1| hypothetical protein MTR_5g067940 [Medicago truncatula] Length = 69 Score = 87.4 bits (215), Expect = 2e-15 Identities = 48/69 (69%), Positives = 51/69 (73%), Gaps = 7/69 (10%) Frame = -1 Query: 303 MAKLVDATDLIGLSLSKETC*VVTSKFRETLEFKMGNPEPNP*F-------YQTRIKKRI 145 MA+LVDATDLIGLSL ET V T KFRETLE KMGNPEPNP F ++ KKRI Sbjct: 1 MAELVDATDLIGLSLGMETYQVKTFKFRETLELKMGNPEPNPSFRKQINKSLESENKKRI 60 Query: 144 GAETQWKLF 118 GAETQWKLF Sbjct: 61 GAETQWKLF 69 >ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago truncatula] gi|357471517|ref|XP_003606043.1| hypothetical protein MTR_4g051230 [Medicago truncatula] gi|358349395|ref|XP_003638723.1| hypothetical protein MTR_141s0027 [Medicago truncatula] gi|355504658|gb|AES85861.1| hypothetical protein MTR_141s0027 [Medicago truncatula] gi|355506677|gb|AES87819.1| hypothetical protein MTR_4g035030 [Medicago truncatula] gi|355507098|gb|AES88240.1| hypothetical protein MTR_4g051230 [Medicago truncatula] Length = 95 Score = 72.8 bits (177), Expect = 4e-11 Identities = 40/61 (65%), Positives = 46/61 (75%) Frame = -1 Query: 303 MAKLVDATDLIGLSLSKETC*VVTSKFRETLEFKMGNPEPNP*FYQTRIKKRIGAETQWK 124 MAKLVDATDLIGLSL ET V T KFRETLE KMGNPEPNP F + +I K + +E Q + Sbjct: 1 MAKLVDATDLIGLSLGMETYQVKTFKFRETLELKMGNPEPNPSF-RKQINKSLESENQKR 59 Query: 123 L 121 + Sbjct: 60 I 60 >tpg|DAA62789.1| TPA: hypothetical protein ZEAMMB73_456670 [Zea mays] Length = 73 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = +3 Query: 177 KDLAQDCPF*IPGFL*IWKLPLSRFPY*GSIQ 272 KDLAQDCPF I GFL IWKLPLSRFPY GSIQ Sbjct: 39 KDLAQDCPFFIRGFLGIWKLPLSRFPYQGSIQ 70 >tpg|DAA39238.1| TPA: hypothetical protein ZEAMMB73_219766 [Zea mays] Length = 60 Score = 40.8 bits (94), Expect(2) = 9e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = +2 Query: 179 GFGSGLPILNSRVSLNLEVTT 241 GFGSGLPI +SRVSLNLEVTT Sbjct: 40 GFGSGLPIFHSRVSLNLEVTT 60 Score = 34.3 bits (77), Expect(2) = 9e-06 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = +1 Query: 97 RSQLHSLEQLPLSLCTYPFFYSSLIK 174 R SLEQLPLSLCTYPF S ++ Sbjct: 7 RYYFDSLEQLPLSLCTYPFPLGSSLR 32