BLASTX nr result
ID: Zingiber23_contig00037952
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00037952 (297 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003566837.1| PREDICTED: sigma factor sigB regulation prot... 56 6e-06 ref|XP_002515580.1| sigma factor sigb regulation protein rsbq, p... 55 7e-06 >ref|XP_003566837.1| PREDICTED: sigma factor sigB regulation protein rsbQ-like [Brachypodium distachyon] Length = 270 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/59 (42%), Positives = 35/59 (59%) Frame = +1 Query: 49 NVRLIGEGEPTVVLAHGYGIDQSAWDXXXXXXXXXXXXXXFDWNFAGAGSGIADADEHE 225 N R++G GE T+VL+HGYG Q+ WD FDW+F+ AG+G A+ +E E Sbjct: 4 NPRIVGCGERTLVLSHGYGGSQAIWDKVLPHLSKNNKVLLFDWDFSAAGAGEAEEEEEE 62 >ref|XP_002515580.1| sigma factor sigb regulation protein rsbq, putative [Ricinus communis] gi|223545524|gb|EEF47029.1| sigma factor sigb regulation protein rsbq, putative [Ricinus communis] Length = 276 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/64 (43%), Positives = 36/64 (56%), Gaps = 2/64 (3%) Frame = +1 Query: 49 NVRLIGEGEPTVVLAHGYGIDQSAWDXXXXXXXXXXXXXXFDWNFAGA--GSGIADADEH 222 N ++IG GE T+VLAHGYG DQSAWD FDW F+GA + D +++ Sbjct: 13 NAKVIGTGEETIVLAHGYGGDQSAWDKIVPDLAKYFRILVFDWLFSGAVKDQQLFDPEKY 72 Query: 223 ESVD 234 S D Sbjct: 73 ASFD 76