BLASTX nr result
ID: Zingiber23_contig00037861
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00037861 (237 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004951464.1| PREDICTED: uncharacterized protein LOC101770... 55 7e-06 >ref|XP_004951464.1| PREDICTED: uncharacterized protein LOC101770571 [Setaria italica] Length = 171 Score = 55.5 bits (132), Expect = 7e-06 Identities = 32/77 (41%), Positives = 43/77 (55%), Gaps = 5/77 (6%) Frame = -3 Query: 220 HGSEPPGPP----HPVDAPRRRRRT-WLSVFPLLYLSASAAVYGYRERGDPWSLAFVLFS 56 H + P PP HP DAP WL+ +L ++ + +R RGD ++AFV FS Sbjct: 21 HLPQAPPPPASDGHPADAPPAGHSVRWLAAAGFAFLIFNSGMAVHRSRGDLGAIAFVAFS 80 Query: 55 YSDLLALFYCLGRFERA 5 + DLLALF CL R+E A Sbjct: 81 HLDLLALFLCLRRYEGA 97