BLASTX nr result
ID: Zingiber23_contig00037387
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00037387 (266 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ94063.1| predicted protein [Hordeum vulgare subsp. vulgare] 55 7e-06 >dbj|BAJ94063.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 576 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/57 (43%), Positives = 31/57 (54%) Frame = +3 Query: 18 PDRENGYPHAQTSTETIFSRRTANPSPGLRGYRFPTSPVHPSSFGLFPTSPNSWQDN 188 P Y H + STE +F+ R + P RG PTSPVH +FG P SP WQD+ Sbjct: 163 PSDRTTYCHGRKSTEIVFATRMPSSPPSSRGKHCPTSPVHSRAFGQCPGSPTGWQDD 219