BLASTX nr result
ID: Zingiber23_contig00037384
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00037384 (468 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006856731.1| hypothetical protein AMTR_s00054p00206420 [A... 58 1e-06 gb|ADV02777.1| C3HC4-type zinc RING finger family protein [Ipomo... 57 2e-06 gb|EMT04504.1| hypothetical protein F775_05039 [Aegilops tauschii] 55 7e-06 gb|EMS49582.1| hypothetical protein TRIUR3_12761 [Triticum urartu] 55 7e-06 ref|XP_003562777.1| PREDICTED: RING finger protein 170-like [Bra... 55 7e-06 ref|NP_001051839.1| Os03g0839000 [Oryza sativa Japonica Group] g... 55 1e-05 ref|XP_002325966.1| zinc finger family protein [Populus trichoca... 55 1e-05 >ref|XP_006856731.1| hypothetical protein AMTR_s00054p00206420 [Amborella trichopoda] gi|548860631|gb|ERN18198.1| hypothetical protein AMTR_s00054p00206420 [Amborella trichopoda] Length = 187 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +2 Query: 2 RRLLREFVDPQRALPFVFRARTALSILLSIGYVASPIDILSE 127 RRLLRE +DPQR+LP VFRAR +S+ +S+ YV SPIDIL E Sbjct: 108 RRLLRELMDPQRSLPLVFRARIFISMFVSVLYVLSPIDILPE 149 >gb|ADV02777.1| C3HC4-type zinc RING finger family protein [Ipomoea batatas] Length = 186 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = +2 Query: 2 RRLLREFVDPQRALPFVFRARTALSILLSIGYVASPIDILSE 127 RRLLRE DPQR+LPFV RAR L+ LS+ YV SPIDI+ E Sbjct: 107 RRLLREITDPQRSLPFVIRARVYLAAFLSVLYVLSPIDIIPE 148 >gb|EMT04504.1| hypothetical protein F775_05039 [Aegilops tauschii] Length = 309 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = +2 Query: 2 RRLLREFVDPQRALPFVFRARTALSILLSIGYVASPIDILSE 127 RRL RE +DPQR LP VFRAR L ++LS YV SP+DIL E Sbjct: 28 RRLFRELMDPQRTLPLVFRARMILMVILSGVYVLSPVDILPE 69 >gb|EMS49582.1| hypothetical protein TRIUR3_12761 [Triticum urartu] Length = 158 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = +2 Query: 2 RRLLREFVDPQRALPFVFRARTALSILLSIGYVASPIDILSE 127 RRL RE +DPQR LP VFRAR L ++LS YV SP+DIL E Sbjct: 80 RRLFRELMDPQRTLPLVFRARMILMVILSGVYVLSPVDILPE 121 >ref|XP_003562777.1| PREDICTED: RING finger protein 170-like [Brachypodium distachyon] Length = 197 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/42 (64%), Positives = 30/42 (71%) Frame = +2 Query: 2 RRLLREFVDPQRALPFVFRARTALSILLSIGYVASPIDILSE 127 RRL RE +DPQR LP VFRAR L + LS YV SP+DIL E Sbjct: 119 RRLFRELMDPQRTLPLVFRARMILMVALSAVYVLSPVDILPE 160 >ref|NP_001051839.1| Os03g0839000 [Oryza sativa Japonica Group] gi|28376707|gb|AAO41137.1| unknown protein [Oryza sativa Japonica Group] gi|108711996|gb|ABF99791.1| zinc finger family protein, putative, expressed [Oryza sativa Japonica Group] gi|113550310|dbj|BAF13753.1| Os03g0839000 [Oryza sativa Japonica Group] gi|215687212|dbj|BAG91777.1| unnamed protein product [Oryza sativa Japonica Group] gi|222626133|gb|EEE60265.1| hypothetical protein OsJ_13296 [Oryza sativa Japonica Group] Length = 191 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/42 (64%), Positives = 30/42 (71%) Frame = +2 Query: 2 RRLLREFVDPQRALPFVFRARTALSILLSIGYVASPIDILSE 127 RRL RE +DPQR LP VFRAR + + LS YV SPIDIL E Sbjct: 113 RRLFRELLDPQRTLPLVFRARMVMMVALSAIYVLSPIDILPE 154 >ref|XP_002325966.1| zinc finger family protein [Populus trichocarpa] gi|222862841|gb|EEF00348.1| zinc finger family protein [Populus trichocarpa] Length = 185 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +2 Query: 2 RRLLREFVDPQRALPFVFRARTALSILLSIGYVASPIDILSE 127 RRLLRE +DPQR+LP V RAR ++++LS YV SPIDI+ E Sbjct: 107 RRLLREIMDPQRSLPLVIRARVYIAVVLSAIYVISPIDIIPE 148