BLASTX nr result
ID: Zingiber23_contig00037215
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00037215 (209 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_005415583.1| hypothetical protein RSPPHO_03274, partial [... 79 5e-13 emb|CCG06598.1| Putative uncharacterized protein, partial [Rhodo... 78 1e-12 ref|WP_004595993.1| hypothetical protein [Rickettsia prowazekii]... 51 8e-11 ref|WP_009466332.1| hypothetical protein [Roseibium sp. TrichSKD... 60 2e-07 >ref|YP_005415583.1| hypothetical protein RSPPHO_03274, partial [Rhodospirillum photometricum DSM 122] gi|504226152|ref|WP_014413254.1| hypothetical protein, partial [Rhodospirillum photometricum] gi|378401497|emb|CCG06613.1| Putative uncharacterized protein, partial [Rhodospirillum photometricum DSM 122] Length = 150 Score = 79.3 bits (194), Expect = 5e-13 Identities = 40/67 (59%), Positives = 46/67 (68%) Frame = -1 Query: 203 FLQHSSLKRLGILYQSTCVGFGYGLMWRLFPGTPSKPNQSIKVGQHTGFVTIHWLQNIHC 24 FLQH SLKRLGILYQ TCVG GYG LFPG P +P+QS K+ Q VT+H L+ I+ Sbjct: 1 FLQHHSLKRLGILYQPTCVGLGYGSYVGLFPGLPWRPDQSDKIRQRPEGVTLHELRTINL 60 Query: 23 IPIDYAF 3 I I Y F Sbjct: 61 IAIAYGF 67 >emb|CCG06598.1| Putative uncharacterized protein, partial [Rhodospirillum photometricum DSM 122] Length = 150 Score = 78.2 bits (191), Expect = 1e-12 Identities = 40/67 (59%), Positives = 45/67 (67%) Frame = -1 Query: 203 FLQHSSLKRLGILYQSTCVGFGYGLMWRLFPGTPSKPNQSIKVGQHTGFVTIHWLQNIHC 24 FLQH SLKRLGILYQ TCVG GYG LFPG P +P+QS K Q VT+H L+ I+ Sbjct: 1 FLQHHSLKRLGILYQPTCVGLGYGSYVGLFPGLPWRPDQSDKTRQRPEGVTLHELRTINL 60 Query: 23 IPIDYAF 3 I I Y F Sbjct: 61 IAIAYGF 67 >ref|WP_004595993.1| hypothetical protein [Rickettsia prowazekii] gi|484358049|gb|EOB10733.1| hypothetical protein H376_690 [Rickettsia prowazekii str. GvF12] gi|484358399|gb|EOB11076.1| hypothetical protein H377_530 [Rickettsia prowazekii str. Cairo 3] Length = 156 Score = 50.8 bits (120), Expect(2) = 8e-11 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = -3 Query: 204 VPST*FSQAPWYTLPVHLCRFRVRSNVEAI 115 VPS FSQAPWYTLPVHLCRF VRS ++ + Sbjct: 24 VPSASFSQAPWYTLPVHLCRFWVRSIIKVL 53 Score = 41.2 bits (95), Expect(2) = 8e-11 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = -1 Query: 119 LFPGTPSKPNQSIKVGQHTGFVTIHWLQNIHCIPIDYAF 3 LFPG S NQS K Q T FVT +NI+ IPIDYAF Sbjct: 53 LFPGKYSLHNQSNKTIQFTIFVTSFRFRNINLIPIDYAF 91 >ref|WP_009466332.1| hypothetical protein [Roseibium sp. TrichSKD4] gi|307769360|gb|EFO28588.1| conserved hypothetical protein [Roseibium sp. TrichSKD4] gi|307772078|gb|EFO31301.1| conserved hypothetical protein [Roseibium sp. TrichSKD4] gi|307772895|gb|EFO32114.1| conserved hypothetical protein [Roseibium sp. TrichSKD4] gi|307772930|gb|EFO32147.1| conserved hypothetical protein [Roseibium sp. TrichSKD4] gi|307774094|gb|EFO33310.1| conserved hypothetical protein [Roseibium sp. TrichSKD4] gi|307774317|gb|EFO33529.1| conserved hypothetical protein [Roseibium sp. TrichSKD4] Length = 60 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/41 (73%), Positives = 30/41 (73%), Gaps = 5/41 (12%) Frame = -1 Query: 209 AEFLQHSSLKRLGILYQSTCVGFGYGL-----MWRLFPGTP 102 AEFLQHSSLKRLGILYQSTCVGFGYGL W F P Sbjct: 18 AEFLQHSSLKRLGILYQSTCVGFGYGLYGGAISWNTFAAPP 58