BLASTX nr result
ID: Zingiber23_contig00037116
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00037116 (274 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEY84978.1| histidine-containing phosphotransfer protein [Wol... 58 1e-06 >gb|AEY84978.1| histidine-containing phosphotransfer protein [Wolffia australiana] Length = 146 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +3 Query: 3 RQFYDENNKEGCLSALNVVECEYFRLKDKLAVMLQLEQTIQAYE 134 RQF + NKEGC ALN++ EY+RLK KL +M+QLE+ IQAYE Sbjct: 101 RQFCEAKNKEGCAHALNLIRHEYYRLKVKLEMMVQLERRIQAYE 144