BLASTX nr result
ID: Zingiber23_contig00037087
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00037087 (252 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004958300.1| PREDICTED: protein TIFY 10B-like [Setaria it... 55 1e-05 gb|EMS48227.1| Protein TIFY 10A [Triticum urartu] 55 1e-05 >ref|XP_004958300.1| PREDICTED: protein TIFY 10B-like [Setaria italica] Length = 237 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -1 Query: 177 SMVANSWLTAQTSLSDLPIARKASLQRFLEKRKYRINARAPYQ 49 + A++ A+T+ SD+PIARKASL RFLEKRK R+NA+ PYQ Sbjct: 164 AQAADAQKPARTNASDMPIARKASLHRFLEKRKDRLNAKTPYQ 206 >gb|EMS48227.1| Protein TIFY 10A [Triticum urartu] Length = 161 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = -1 Query: 186 TLESMVANSWLTAQTSLSDLPIARKASLQRFLEKRKYRINARAPYQ 49 +L S N+ +A+ + SDLPIARKASL RFLEKRK R++A+APYQ Sbjct: 85 SLPSDPVNAHKSARPNASDLPIARKASLHRFLEKRKDRLHAKAPYQ 130