BLASTX nr result
ID: Zingiber23_contig00036923
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00036923 (244 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBJ20712.1| hypothetical protein [Beta vulgaris subsp. marit... 136 3e-30 ref|NP_063994.2| orf25 gene product (mitochondrion) [Beta vulgar... 134 1e-29 ref|YP_003875506.1| ATPase subunit 4 [Silene latifolia] gi|29604... 134 1e-29 ref|YP_005090375.1| ATP synthase F0 subunit 4 (mitochondrion) [P... 133 2e-29 gb|AHA47106.1| ATPase subunit 4 (mitochondrion) [Amborella trich... 132 4e-29 gb|AFB35015.1| ATP synthase subunit b, partial (mitochondrion) [... 131 8e-29 gb|AFB35012.1| ATP synthase subunit b, partial (mitochondrion) [... 131 8e-29 gb|AFB34996.1| ATP synthase subunit b (mitochondrion) [Phormium ... 131 8e-29 gb|AFB35014.1| ATP synthase subunit b, partial (mitochondrion) [... 129 3e-28 gb|AFB35013.1| ATP synthase subunit b, partial (mitochondrion) [... 129 3e-28 gb|AFB35007.1| ATP synthase subunit b (mitochondrion) [Aphyllant... 129 3e-28 gb|AFB35003.1| ATP synthase subunit b (mitochondrion) [Xeronema ... 129 3e-28 ref|YP_004842186.1| hypothetical protein BemaM_p142 [Beta macroc... 129 4e-28 ref|YP_004935350.1| ATPase subunit 4 (mitochondrion) [Silene vul... 129 4e-28 gb|AFB35009.1| ATP synthase subunit b (mitochondrion) [Hemiphyla... 128 7e-28 gb|AFB35005.1| ATP synthase subunit b, partial (mitochondrion) [... 128 7e-28 gb|AFB34997.1| ATP synthase subunit b, partial (mitochondrion) [... 128 7e-28 gb|AFB34992.1| ATP synthase subunit b (mitochondrion) [Ornithoga... 128 7e-28 ref|YP_003587262.1| ATPase subunit 4 [Citrullus lanatus] gi|2591... 128 7e-28 ref|YP_398412.1| atp4(=orf25) [Triticum aestivum] gi|556927197|r... 127 1e-27 >emb|CBJ20712.1| hypothetical protein [Beta vulgaris subsp. maritima] Length = 198 Score = 136 bits (342), Expect = 3e-30 Identities = 71/79 (89%), Positives = 72/79 (91%) Frame = +3 Query: 6 ARCAPKCEKTVQALLCRNLNVKLATLLNAISSRRTCLQGDIVTGLNFSVRERFVPGSTLK 185 ARCAPKCEKTVQALLCRNLNVKLATLLNA SSRRT LQ D+VTG NFSV ERFVPGSTLK Sbjct: 110 ARCAPKCEKTVQALLCRNLNVKLATLLNATSSRRTRLQDDLVTGFNFSVSERFVPGSTLK 169 Query: 186 ASIVELIREGLLVLRKVRV 242 ASIVELIREGL VLR VRV Sbjct: 170 ASIVELIREGLAVLRMVRV 188 >ref|NP_063994.2| orf25 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435162|ref|YP_004222380.1| hypothetical protein BevumaM_p147 [Beta vulgaris subsp. maritima] gi|7592785|dbj|BAA94421.1| orf25 [Beta vulgaris subsp. vulgaris] gi|148491415|dbj|BAA99306.2| orf25 [Beta vulgaris subsp. vulgaris] gi|317905613|emb|CBJ14018.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|317905646|emb|CBJ14046.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439895|emb|CBJ17594.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|384977902|emb|CBL54126.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 198 Score = 134 bits (337), Expect = 1e-29 Identities = 70/79 (88%), Positives = 72/79 (91%) Frame = +3 Query: 6 ARCAPKCEKTVQALLCRNLNVKLATLLNAISSRRTCLQGDIVTGLNFSVRERFVPGSTLK 185 ARCAPKCEKTVQALLCRNLNVKLATLLNA SSRRT LQ D+VTG +FSV ERFVPGSTLK Sbjct: 110 ARCAPKCEKTVQALLCRNLNVKLATLLNATSSRRTRLQDDLVTGFHFSVSERFVPGSTLK 169 Query: 186 ASIVELIREGLLVLRKVRV 242 ASIVELIREGL VLR VRV Sbjct: 170 ASIVELIREGLAVLRMVRV 188 >ref|YP_003875506.1| ATPase subunit 4 [Silene latifolia] gi|296040807|gb|ADG85371.1| ATPase subunit 4 [Silene latifolia] gi|301338016|gb|ADK73308.1| ATPase subunit 4 [Silene latifolia] Length = 198 Score = 134 bits (337), Expect = 1e-29 Identities = 70/79 (88%), Positives = 72/79 (91%) Frame = +3 Query: 6 ARCAPKCEKTVQALLCRNLNVKLATLLNAISSRRTCLQGDIVTGLNFSVRERFVPGSTLK 185 ARCAPKCEKTVQALLCRNLNVKLATLLNA SSRRT LQ D+VTG +FSV ERFVPGSTLK Sbjct: 110 ARCAPKCEKTVQALLCRNLNVKLATLLNATSSRRTRLQDDLVTGFHFSVSERFVPGSTLK 169 Query: 186 ASIVELIREGLLVLRKVRV 242 ASIVELIREGL VLR VRV Sbjct: 170 ASIVELIREGLAVLRMVRV 188 >ref|YP_005090375.1| ATP synthase F0 subunit 4 (mitochondrion) [Phoenix dactylifera] gi|343478428|gb|AEM43916.1| ATP synthase F0 subunit 4 (mitochondrion) [Phoenix dactylifera] Length = 195 Score = 133 bits (335), Expect = 2e-29 Identities = 70/80 (87%), Positives = 72/80 (90%) Frame = +3 Query: 3 TARCAPKCEKTVQALLCRNLNVKLATLLNAISSRRTCLQGDIVTGLNFSVRERFVPGSTL 182 TARCAPKCEKTVQALLCRNLNVK ATLLNA SSRR LQ DIVTG +FSV ERFVPG TL Sbjct: 109 TARCAPKCEKTVQALLCRNLNVKSATLLNATSSRRIRLQDDIVTGFHFSVSERFVPGCTL 168 Query: 183 KASIVELIREGLLVLRKVRV 242 KASIVELIREGL+VLRKVRV Sbjct: 169 KASIVELIREGLVVLRKVRV 188 >gb|AHA47106.1| ATPase subunit 4 (mitochondrion) [Amborella trichopoda] Length = 195 Score = 132 bits (333), Expect = 4e-29 Identities = 70/80 (87%), Positives = 72/80 (90%) Frame = +3 Query: 3 TARCAPKCEKTVQALLCRNLNVKLATLLNAISSRRTCLQGDIVTGLNFSVRERFVPGSTL 182 TARCAPKCEKTVQALLCRNLNVKLA LLNAISSRR LQ DIVTG + SV ERFVPGSTL Sbjct: 109 TARCAPKCEKTVQALLCRNLNVKLARLLNAISSRRIRLQDDIVTGFHLSVSERFVPGSTL 168 Query: 183 KASIVELIREGLLVLRKVRV 242 KASIVELIREGL+VLR VRV Sbjct: 169 KASIVELIREGLVVLRMVRV 188 >gb|AFB35015.1| ATP synthase subunit b, partial (mitochondrion) [Xanthorrhoea preissii] Length = 141 Score = 131 bits (330), Expect = 8e-29 Identities = 70/80 (87%), Positives = 72/80 (90%) Frame = +3 Query: 3 TARCAPKCEKTVQALLCRNLNVKLATLLNAISSRRTCLQGDIVTGLNFSVRERFVPGSTL 182 TAR APKCEKTVQALLCRNLNVK ATLLNA SSRR LQ DIVTG +FSV ERFVPGSTL Sbjct: 55 TARSAPKCEKTVQALLCRNLNVKSATLLNATSSRRIRLQDDIVTGFHFSVSERFVPGSTL 114 Query: 183 KASIVELIREGLLVLRKVRV 242 KASIVELIREGL+VLRKVRV Sbjct: 115 KASIVELIREGLVVLRKVRV 134 >gb|AFB35012.1| ATP synthase subunit b, partial (mitochondrion) [Amaryllis belladonna] Length = 157 Score = 131 bits (330), Expect = 8e-29 Identities = 70/80 (87%), Positives = 72/80 (90%) Frame = +3 Query: 3 TARCAPKCEKTVQALLCRNLNVKLATLLNAISSRRTCLQGDIVTGLNFSVRERFVPGSTL 182 TAR APKCEKTVQALLCRNLNVKLATLLNAISSRR LQ DIVTG +F V ERFVPG TL Sbjct: 71 TARSAPKCEKTVQALLCRNLNVKLATLLNAISSRRIRLQDDIVTGFHFVVSERFVPGCTL 130 Query: 183 KASIVELIREGLLVLRKVRV 242 KASIVELIREGL+VLRKVRV Sbjct: 131 KASIVELIREGLVVLRKVRV 150 >gb|AFB34996.1| ATP synthase subunit b (mitochondrion) [Phormium tenax] Length = 192 Score = 131 bits (330), Expect = 8e-29 Identities = 70/80 (87%), Positives = 72/80 (90%) Frame = +3 Query: 3 TARCAPKCEKTVQALLCRNLNVKLATLLNAISSRRTCLQGDIVTGLNFSVRERFVPGSTL 182 TAR APKCEKTVQALLCRNLNVK ATLLNA SSRR LQ DIVTG +FSV ERFVPGSTL Sbjct: 106 TARSAPKCEKTVQALLCRNLNVKSATLLNATSSRRIRLQDDIVTGFHFSVSERFVPGSTL 165 Query: 183 KASIVELIREGLLVLRKVRV 242 KASIVELIREGL+VLRKVRV Sbjct: 166 KASIVELIREGLVVLRKVRV 185 >gb|AFB35014.1| ATP synthase subunit b, partial (mitochondrion) [Doryanthes palmeri] Length = 180 Score = 129 bits (325), Expect = 3e-28 Identities = 69/80 (86%), Positives = 71/80 (88%) Frame = +3 Query: 3 TARCAPKCEKTVQALLCRNLNVKLATLLNAISSRRTCLQGDIVTGLNFSVRERFVPGSTL 182 TAR APKCEKTVQALLCRNLNVK ATLLNA SSRR LQ DIVTG +FSV ERFVPG TL Sbjct: 94 TARSAPKCEKTVQALLCRNLNVKSATLLNATSSRRIRLQDDIVTGFHFSVSERFVPGCTL 153 Query: 183 KASIVELIREGLLVLRKVRV 242 KASIVELIREGL+VLRKVRV Sbjct: 154 KASIVELIREGLVVLRKVRV 173 >gb|AFB35013.1| ATP synthase subunit b, partial (mitochondrion) [Manfreda virginica] Length = 164 Score = 129 bits (325), Expect = 3e-28 Identities = 69/80 (86%), Positives = 71/80 (88%) Frame = +3 Query: 3 TARCAPKCEKTVQALLCRNLNVKLATLLNAISSRRTCLQGDIVTGLNFSVRERFVPGSTL 182 TAR APKCEKTVQALLCRNLNVK ATLLNA SSRR LQ DIVTG +FSV ERFVPG TL Sbjct: 78 TARSAPKCEKTVQALLCRNLNVKSATLLNATSSRRIRLQDDIVTGFHFSVSERFVPGCTL 137 Query: 183 KASIVELIREGLLVLRKVRV 242 KASIVELIREGL+VLRKVRV Sbjct: 138 KASIVELIREGLVVLRKVRV 157 >gb|AFB35007.1| ATP synthase subunit b (mitochondrion) [Aphyllanthes monspeliensis] Length = 195 Score = 129 bits (325), Expect = 3e-28 Identities = 69/80 (86%), Positives = 71/80 (88%) Frame = +3 Query: 3 TARCAPKCEKTVQALLCRNLNVKLATLLNAISSRRTCLQGDIVTGLNFSVRERFVPGSTL 182 TAR APKCEKTVQALLCRNLNVK ATLLNA SSRR LQ DIVTG +FSV ERFVPG TL Sbjct: 109 TARSAPKCEKTVQALLCRNLNVKSATLLNATSSRRIRLQDDIVTGFHFSVSERFVPGCTL 168 Query: 183 KASIVELIREGLLVLRKVRV 242 KASIVELIREGL+VLRKVRV Sbjct: 169 KASIVELIREGLVVLRKVRV 188 >gb|AFB35003.1| ATP synthase subunit b (mitochondrion) [Xeronema callistemon] Length = 195 Score = 129 bits (325), Expect = 3e-28 Identities = 69/80 (86%), Positives = 71/80 (88%) Frame = +3 Query: 3 TARCAPKCEKTVQALLCRNLNVKLATLLNAISSRRTCLQGDIVTGLNFSVRERFVPGSTL 182 TAR APKCEKTVQALLCRNLNVK ATLLNA SSRR LQ DIVTG +FSV ERFVPG TL Sbjct: 109 TARSAPKCEKTVQALLCRNLNVKSATLLNATSSRRIRLQDDIVTGFHFSVSERFVPGCTL 168 Query: 183 KASIVELIREGLLVLRKVRV 242 KASIVELIREGL+VLRKVRV Sbjct: 169 KASIVELIREGLVVLRKVRV 188 >ref|YP_004842186.1| hypothetical protein BemaM_p142 [Beta macrocarpa] gi|54606726|dbj|BAD66749.1| 25 kDa membrane protein [Beta vulgaris subsp. vulgaris] gi|345500172|emb|CBX24991.1| hypothetical protein [Beta macrocarpa] Length = 198 Score = 129 bits (324), Expect = 4e-28 Identities = 68/79 (86%), Positives = 70/79 (88%) Frame = +3 Query: 6 ARCAPKCEKTVQALLCRNLNVKLATLLNAISSRRTCLQGDIVTGLNFSVRERFVPGSTLK 185 ARCAPKCEKTVQALLCRNLNVK ATL NA SSRRT LQ D+VTG +FSV ERFVPGSTLK Sbjct: 110 ARCAPKCEKTVQALLCRNLNVKSATLPNATSSRRTRLQDDLVTGFHFSVSERFVPGSTLK 169 Query: 186 ASIVELIREGLLVLRKVRV 242 ASIVELIREGL VLR VRV Sbjct: 170 ASIVELIREGLAVLRMVRV 188 >ref|YP_004935350.1| ATPase subunit 4 (mitochondrion) [Silene vulgaris] gi|344227996|gb|AEM46181.1| ATPase subunit 4 (mitochondrion) [Silene vulgaris] gi|385198360|gb|AFI44256.1| ATPase subunit 4 (mitochondrion) [Silene vulgaris] gi|385198421|gb|AFI44309.1| ATPase subunit 4 (mitochondrion) [Silene vulgaris] gi|385198426|gb|AFI44312.1| ATPase subunit 4 (mitochondrion) [Silene vulgaris] Length = 198 Score = 129 bits (324), Expect = 4e-28 Identities = 68/79 (86%), Positives = 70/79 (88%) Frame = +3 Query: 6 ARCAPKCEKTVQALLCRNLNVKLATLLNAISSRRTCLQGDIVTGLNFSVRERFVPGSTLK 185 ARCAPKCEKTVQALLCRNLNVK ATL NA SSRRT LQ D+VTG +FSV ERFVPGSTLK Sbjct: 110 ARCAPKCEKTVQALLCRNLNVKSATLPNATSSRRTRLQDDLVTGFHFSVSERFVPGSTLK 169 Query: 186 ASIVELIREGLLVLRKVRV 242 ASIVELIREGL VLR VRV Sbjct: 170 ASIVELIREGLAVLRMVRV 188 >gb|AFB35009.1| ATP synthase subunit b (mitochondrion) [Hemiphylacus alatostylus] Length = 195 Score = 128 bits (322), Expect = 7e-28 Identities = 68/80 (85%), Positives = 71/80 (88%) Frame = +3 Query: 3 TARCAPKCEKTVQALLCRNLNVKLATLLNAISSRRTCLQGDIVTGLNFSVRERFVPGSTL 182 TAR APKCEKTVQALLCRNLNVK ATLLNA SSRR LQ DIVTG +FSV ERFVPG TL Sbjct: 109 TARSAPKCEKTVQALLCRNLNVKSATLLNATSSRRIRLQDDIVTGFHFSVSERFVPGCTL 168 Query: 183 KASIVELIREGLLVLRKVRV 242 KASIVELIREGL+VL+KVRV Sbjct: 169 KASIVELIREGLVVLKKVRV 188 >gb|AFB35005.1| ATP synthase subunit b, partial (mitochondrion) [Haworthia cymbiformis] Length = 116 Score = 128 bits (322), Expect = 7e-28 Identities = 68/80 (85%), Positives = 71/80 (88%) Frame = +3 Query: 3 TARCAPKCEKTVQALLCRNLNVKLATLLNAISSRRTCLQGDIVTGLNFSVRERFVPGSTL 182 TAR APKCEKTVQALLCRNLNVK ATLLNA SSRR LQ DIVTG +FSV E+FVPG TL Sbjct: 31 TARSAPKCEKTVQALLCRNLNVKSATLLNATSSRRIRLQDDIVTGFHFSVSEKFVPGCTL 90 Query: 183 KASIVELIREGLLVLRKVRV 242 KASIVELIREGL+VLRKVRV Sbjct: 91 KASIVELIREGLVVLRKVRV 110 >gb|AFB34997.1| ATP synthase subunit b, partial (mitochondrion) [Asparagus officinalis] Length = 181 Score = 128 bits (322), Expect = 7e-28 Identities = 68/80 (85%), Positives = 71/80 (88%) Frame = +3 Query: 3 TARCAPKCEKTVQALLCRNLNVKLATLLNAISSRRTCLQGDIVTGLNFSVRERFVPGSTL 182 TAR APKCEKTVQALLCRNLNVK ATLLNA SSRR LQ DIVTG +FSV ERFVPG TL Sbjct: 97 TARSAPKCEKTVQALLCRNLNVKSATLLNATSSRRIRLQDDIVTGFHFSVSERFVPGCTL 156 Query: 183 KASIVELIREGLLVLRKVRV 242 KASIVELIREGL+VL+KVRV Sbjct: 157 KASIVELIREGLVVLKKVRV 176 >gb|AFB34992.1| ATP synthase subunit b (mitochondrion) [Ornithogalum tenuifolium] Length = 195 Score = 128 bits (322), Expect = 7e-28 Identities = 69/80 (86%), Positives = 70/80 (87%) Frame = +3 Query: 3 TARCAPKCEKTVQALLCRNLNVKLATLLNAISSRRTCLQGDIVTGLNFSVRERFVPGSTL 182 TAR APKCEKTVQALLCRNLNVK ATLLNA SSRR LQ DIVTG FSV ERFVPG TL Sbjct: 109 TARSAPKCEKTVQALLCRNLNVKSATLLNATSSRRIRLQDDIVTGFYFSVSERFVPGCTL 168 Query: 183 KASIVELIREGLLVLRKVRV 242 KASIVELIREGL+VLRKVRV Sbjct: 169 KASIVELIREGLVVLRKVRV 188 >ref|YP_003587262.1| ATPase subunit 4 [Citrullus lanatus] gi|259156762|gb|ACV96624.1| ATPase subunit 4 [Citrullus lanatus] Length = 198 Score = 128 bits (322), Expect = 7e-28 Identities = 68/79 (86%), Positives = 71/79 (89%) Frame = +3 Query: 6 ARCAPKCEKTVQALLCRNLNVKLATLLNAISSRRTCLQGDIVTGLNFSVRERFVPGSTLK 185 AR APKCEKTVQALLCRNLNVKLATLLNAISSRR LQ D+VTG +FSV ERFVPG TLK Sbjct: 110 ARYAPKCEKTVQALLCRNLNVKLATLLNAISSRRIRLQDDLVTGFHFSVSERFVPGCTLK 169 Query: 186 ASIVELIREGLLVLRKVRV 242 ASIVELIREGL+VLR VRV Sbjct: 170 ASIVELIREGLVVLRMVRV 188 >ref|YP_398412.1| atp4(=orf25) [Triticum aestivum] gi|556927197|ref|YP_008758155.1| ATP synthase subunit 4 (mitochondrion) [Triticum timopheevii] gi|55977283|sp|P68537.1|MI25_TRITI RecName: Full=ATP synthase protein MI25; AltName: Full=ORF25 gi|55977284|sp|P68538.1|MI25_WHEAT RecName: Full=ATP synthase protein MI25; AltName: Full=ORF25 gi|13707|emb|CAA38209.1| unnamed protein product [Triticum aestivum] gi|397957|emb|CAA44004.1| unnamed protein product [Triticum timopheevii] gi|5360535|dbj|BAA82045.1| ORF25 [Aegilops crassa] gi|5360537|dbj|BAA82046.1| ORF25 [Triticum aestivum] gi|78675251|dbj|BAE47676.1| atp4 [Triticum aestivum] gi|169649062|gb|ACA62623.1| atp4 [Triticum aestivum] gi|549067744|dbj|BAN94716.1| ATP synthase subunit 4 (mitochondrion) [Triticum timopheevii] gi|578888244|gb|AHI16349.1| apt4 (mitochondrion) [Aegilops longissima] gi|578888271|gb|AHI16375.1| atp4 (mitochondrion) [Triticum durum] gi|578888300|gb|AHI16403.1| atp4 (mitochondrion) [Triticum durum] Length = 192 Score = 127 bits (320), Expect = 1e-27 Identities = 66/80 (82%), Positives = 70/80 (87%) Frame = +3 Query: 3 TARCAPKCEKTVQALLCRNLNVKLATLLNAISSRRTCLQGDIVTGLNFSVRERFVPGSTL 182 TARCAPKCEKTVQALLCRNLNVK ATLLNA SSRR LQ DIVTG +FSV ERFV GST Sbjct: 109 TARCAPKCEKTVQALLCRNLNVKSATLLNATSSRRIRLQDDIVTGFHFSVSERFVSGSTF 168 Query: 183 KASIVELIREGLLVLRKVRV 242 KAS ++LIREGL+VLRKVRV Sbjct: 169 KASTIDLIREGLIVLRKVRV 188