BLASTX nr result
ID: Zingiber23_contig00036740
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00036740 (518 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB55755.1| hypothetical protein L484_007751 [Morus notabilis] 58 2e-06 ref|XP_004967842.1| PREDICTED: uncharacterized protein LOC101768... 56 4e-06 gb|EMT16832.1| hypothetical protein F775_02167 [Aegilops tauschii] 55 7e-06 ref|XP_004967841.1| PREDICTED: uncharacterized protein LOC101768... 55 1e-05 >gb|EXB55755.1| hypothetical protein L484_007751 [Morus notabilis] Length = 267 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/58 (46%), Positives = 40/58 (68%) Frame = -1 Query: 179 SMAVSHADLSQKTQWRWRSELGSQFALLFVFLSVIAGLVAFVLCLAAEASRSEATWFA 6 +M V+HADL+ R R++LGS+ + + L+++ GL F+LCL AEA+RSE TW A Sbjct: 4 TMVVTHADLAPS---RRRTDLGSKLGVFLIVLTILCGLFCFILCLIAEATRSEMTWIA 58 >ref|XP_004967842.1| PREDICTED: uncharacterized protein LOC101768279 isoform X2 [Setaria italica] Length = 294 Score = 56.2 bits (134), Expect = 4e-06 Identities = 34/67 (50%), Positives = 45/67 (67%), Gaps = 1/67 (1%) Frame = -1 Query: 200 AKAIPSTSMAVSHADLS-QKTQWRWRSELGSQFALLFVFLSVIAGLVAFVLCLAAEASRS 24 A A+P+ AV+H DLS +K Q R + Q A+ V LSVI GLVAF+LCLAAE SRS Sbjct: 9 AVAMPA---AVTHDDLSLRKAQERRAARSSGQVAVALVALSVICGLVAFILCLAAEGSRS 65 Query: 23 EATWFAL 3 E +++ + Sbjct: 66 EVSYYLM 72 >gb|EMT16832.1| hypothetical protein F775_02167 [Aegilops tauschii] Length = 287 Score = 55.5 bits (132), Expect = 7e-06 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = -1 Query: 173 AVSHADLS-QKTQWRWRSELGSQFALLFVFLSVIAGLVAFVLCLAAEASRSEAT 15 AV+H DLS +K Q R GSQ A+ V LSV+ GLV+F+LCLAAE SRSE + Sbjct: 4 AVTHDDLSLRKAQERRAGRSGSQIAVALVALSVLCGLVSFILCLAAEGSRSEVS 57 >ref|XP_004967841.1| PREDICTED: uncharacterized protein LOC101768279 isoform X1 [Setaria italica] Length = 299 Score = 55.1 bits (131), Expect = 1e-05 Identities = 35/62 (56%), Positives = 42/62 (67%), Gaps = 1/62 (1%) Frame = -1 Query: 200 AKAIPSTSMAVSHADLS-QKTQWRWRSELGSQFALLFVFLSVIAGLVAFVLCLAAEASRS 24 A A+P+ AV+H DLS +K Q R + Q A+ V LSVI GLVAF+LCLAAE SRS Sbjct: 9 AVAMPA---AVTHDDLSLRKAQERRAARSSGQVAVALVALSVICGLVAFILCLAAEGSRS 65 Query: 23 EA 18 EA Sbjct: 66 EA 67