BLASTX nr result
ID: Zingiber23_contig00036666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00036666 (314 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY34545.1| F2P16.20 protein, putative isoform 1 [Theobroma c... 56 4e-06 >gb|EOY34545.1| F2P16.20 protein, putative isoform 1 [Theobroma cacao] Length = 739 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/48 (54%), Positives = 39/48 (81%), Gaps = 1/48 (2%) Frame = -3 Query: 312 LPSLTQHLANVDVLLHKVLNAAQISLEQYQLMADHIMPLGRS-HIASQ 172 +P+LT H+ N +LLHKVL+ AQIS+E+Y++M D I+PLGR+ H ++Q Sbjct: 689 IPALTPHMTNGRMLLHKVLDGAQISMEEYEVMKDLIIPLGRAPHFSAQ 736