BLASTX nr result
ID: Zingiber23_contig00036605
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00036605 (210 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006481123.1| PREDICTED: uncharacterized protein LOC102608... 55 7e-06 ref|XP_006429503.1| hypothetical protein CICLE_v10011494mg [Citr... 55 7e-06 >ref|XP_006481123.1| PREDICTED: uncharacterized protein LOC102608338 [Citrus sinensis] Length = 518 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 1/50 (2%) Frame = -2 Query: 158 MEPAL-KPSSVRNLLLRALLFIVSVFLLRFVYVITVYGGSCTASDYCLLS 12 MEP + KPS +RN+L+R LLF V + ++RF YV+T+ G SC D+C S Sbjct: 2 MEPTVGKPSFLRNILVRVLLFSVLIIVVRFAYVVTIAGESCNLGDFCFFS 51 >ref|XP_006429503.1| hypothetical protein CICLE_v10011494mg [Citrus clementina] gi|557531560|gb|ESR42743.1| hypothetical protein CICLE_v10011494mg [Citrus clementina] Length = 518 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 1/50 (2%) Frame = -2 Query: 158 MEPAL-KPSSVRNLLLRALLFIVSVFLLRFVYVITVYGGSCTASDYCLLS 12 MEP + KPS +RN+L+R LLF V + ++RF YV+T+ G SC D+C S Sbjct: 2 MEPTVGKPSFLRNILVRVLLFSVLIIVVRFAYVVTIAGESCNLGDFCFFS 51