BLASTX nr result
ID: Zingiber23_contig00036549
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber23_contig00036549 (384 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW03738.1| hypothetical protein PHAVU_011G038300g [Phaseolus... 61 2e-07 gb|ESW03737.1| hypothetical protein PHAVU_011G038300g [Phaseolus... 61 2e-07 ref|XP_002306143.2| 3-oxo-5-alpha-steroid 4-dehydrogenase family... 60 3e-07 ref|XP_002313005.1| 3-oxo-5-alpha-steroid 4-dehydrogenase family... 59 9e-07 ref|XP_002531516.1| dfg10 protein, putative [Ricinus communis] g... 57 3e-06 ref|XP_002513007.1| dfg10 protein, putative [Ricinus communis] g... 55 7e-06 gb|EOX90895.1| 3-oxo-5-alpha-steroid 4-dehydrogenase family prot... 55 1e-05 gb|EOX90894.1| 3-oxo-5-alpha-steroid 4-dehydrogenase family prot... 55 1e-05 >gb|ESW03738.1| hypothetical protein PHAVU_011G038300g [Phaseolus vulgaris] Length = 309 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -2 Query: 128 VLRFAWIAATLPILLASLPIRPLGFLHRMLIGFAARGKIMKN 3 +LR AW+AATLPI++ASLPI L FL R LIGFA RGKIM++ Sbjct: 15 ILRAAWLAATLPIVIASLPIPNLSFLRRTLIGFAGRGKIMQS 56 >gb|ESW03737.1| hypothetical protein PHAVU_011G038300g [Phaseolus vulgaris] Length = 340 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -2 Query: 128 VLRFAWIAATLPILLASLPIRPLGFLHRMLIGFAARGKIMKN 3 +LR AW+AATLPI++ASLPI L FL R LIGFA RGKIM++ Sbjct: 15 ILRAAWLAATLPIVIASLPIPNLSFLRRTLIGFAGRGKIMQS 56 >ref|XP_002306143.2| 3-oxo-5-alpha-steroid 4-dehydrogenase family protein [Populus trichocarpa] gi|550341211|gb|EEE86654.2| 3-oxo-5-alpha-steroid 4-dehydrogenase family protein [Populus trichocarpa] Length = 339 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = -2 Query: 149 LPLGFTVVLRFAWIAATLPILLASLPIRPLGFLHRMLIGFAARGKIMKN 3 + LG +LR AWIA TLPIL+ASLP LG H +++GFA RGKIMK+ Sbjct: 1 MELGLVELLRAAWIAGTLPILIASLPCSWLGSFHGLVLGFARRGKIMKS 49 >ref|XP_002313005.1| 3-oxo-5-alpha-steroid 4-dehydrogenase family protein [Populus trichocarpa] gi|222849413|gb|EEE86960.1| 3-oxo-5-alpha-steroid 4-dehydrogenase family protein [Populus trichocarpa] Length = 339 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = -2 Query: 149 LPLGFTVVLRFAWIAATLPILLASLPIRPLGFLHRMLIGFAARGKIMKN 3 + LG +LR AWIA TLPIL+ASLP LG H +++GFA RGKIM++ Sbjct: 1 MELGLVELLRAAWIAGTLPILIASLPCSWLGSFHGLVLGFARRGKIMQS 49 >ref|XP_002531516.1| dfg10 protein, putative [Ricinus communis] gi|223528869|gb|EEF30870.1| dfg10 protein, putative [Ricinus communis] Length = 342 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -2 Query: 128 VLRFAWIAATLPILLASLPIRPLGFLHRMLIGFAARGKIMK 6 +LR AWIA TLPILLASLP L H++L+GFA RGKIM+ Sbjct: 8 LLRLAWIAGTLPILLASLPSSSLNSFHQLLLGFAKRGKIMQ 48 >ref|XP_002513007.1| dfg10 protein, putative [Ricinus communis] gi|223548018|gb|EEF49510.1| dfg10 protein, putative [Ricinus communis] Length = 339 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/49 (51%), Positives = 34/49 (69%) Frame = -2 Query: 149 LPLGFTVVLRFAWIAATLPILLASLPIRPLGFLHRMLIGFAARGKIMKN 3 + G LR AWIA LPI++ASLP LG HR+++GF+ RGKIM++ Sbjct: 1 MEFGLVGFLRVAWIAGILPIVIASLPFPKLGSFHRVILGFSKRGKIMES 49 >gb|EOX90895.1| 3-oxo-5-alpha-steroid 4-dehydrogenase family protein, putative isoform 2 [Theobroma cacao] Length = 356 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/43 (60%), Positives = 31/43 (72%) Frame = -2 Query: 137 FTVVLRFAWIAATLPILLASLPIRPLGFLHRMLIGFAARGKIM 9 F +LR W+A TLPIL+ASLP LG H +L+GFA RGKIM Sbjct: 23 FIWLLRAGWVAGTLPILIASLPSSRLGSFHTLLLGFAKRGKIM 65 >gb|EOX90894.1| 3-oxo-5-alpha-steroid 4-dehydrogenase family protein isoform 1 [Theobroma cacao] Length = 456 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/43 (60%), Positives = 31/43 (72%) Frame = -2 Query: 137 FTVVLRFAWIAATLPILLASLPIRPLGFLHRMLIGFAARGKIM 9 F +LR W+A TLPIL+ASLP LG H +L+GFA RGKIM Sbjct: 100 FIWLLRAGWVAGTLPILIASLPSSRLGSFHTLLLGFAKRGKIM 142